KEGG   Mycobacterium canettii CIPT 140070017: BN45_10041Help
Entry
BN45_10041        CDS       T02422                                 

Gene name
fadD
Definition
(GenBank) Putative fatty-acid-CoA ligase fadD34 (Fatty-Acid-CoA Synthetase)
Organism
mcz  Mycobacterium canettii CIPT 140070017
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
37401..39089
Genome map
AA seq 562 aa AA seqDB search
MTAALVSPAVAWQQIAARTDRTLTITCEDSEVISYHDLIARAAACIPPLRRLDLKRGEPV
LITAHTNLEFLSCFLGLMLHGAVPVPIPPREALKTTERFMARLSPLLRHHRVLICTPAEH
DEIRAAASTDCQISRFTALAEAGDEQFGRATAQQLADTATADWLLCTLDDDAYVQYTSGS
TAAPRGVVITYRNLLSNMRAMAVGSQFEHGDVMGSWLPLHHDMGLVGSLFAALFNGVSAV
FTTPHRFLYDPLGFLRLLTSSGATHTFMPNFALEWLINAYHRRGADIEGIDLHKMRRLII
ASEPIHAEGMRRFAATFAGVGLAPTALGSGYGLAEATVAVSMSAPDTGFRTETHAAAEVV
TGGRVLPGYEVRIDAAPDARAGTIKLRGDSVAAKAYVGGQKLDALDEEGFCDTHDLGFLV
DDEIVILGRQDEVFIVYGENRFPYDIEFIIRRESEQHRTKVACFGVNERVVVVLESQLDS
IIDEAEADRLRCQVVAATGLQLDELITVRRGAIPTTTSGKLKRRAVAQAYRDGTLPRLAT
HAWTADPDSAPKTTRSSLEGAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggccttggtttcaccggccgtcgcttggcagcagatcgcggctcgcacggac
cgcacgctgacgatcacttgcgaggattccgaggtaatcagctaccacgacctcatcgcg
cgcgcggccgcatgcatccccccgctacggcgtcttgacctcaaacgcggtgaacccgtg
ctgatcaccgcccacaccaacctggaattcctgtcctgctttttgggcctcatgctccat
ggcgctgtgccggtacccatcccgccacgggaggcactgaagaccaccgagcgtttcatg
gctcggctcagcccactgctgcgtcatcaccgcgtgctgatctgcacaccggccgaacac
gacgagatacgcgctgccgccagcaccgactgccagatcagcagatttactgccctcgcc
gaggctggcgacgagcagttcggccgcgccacggcccaacaactcgccgacaccgccacc
gccgactggctgctctgcaccctcgacgacgacgcctacgtccaatacacctccggcagc
accgcagcaccacgcggagtggtcatcacctaccgcaacctgctgtccaacatgcgcgca
atggccgtgggctcacaatttgagcacggcgatgtcatgggcagctggctgcccttgcac
catgacatgggactggtgggcagcctgttcgccgcactcttcaacggcgtcagcgcggtg
ttcaccacgccacaccggtttctgtatgacccgttgggattcctcagactgctcaccagc
tccggggctacccacacgttcatgcccaacttcgctctggagtggctgatcaacgcctac
cacaggcgcggcgccgacatcgaaggcatcgacctacacaaaatgcgccgcctgatcatc
gcctccgaacccatccatgccgagggcatgcggagattcgccgccaccttcgccggcgtc
ggacttgcccccacggccctgggttcgggctatggcctggccgaagcgaccgtcgccgtg
tcgatgtcagcgcccgacacgggattccgcaccgaaacccacgccgccgcggaggtcgtc
accggcggccgagtgctgcctggctacgaggtgcgcattgacgccgcaccagatgcccgg
gccggaacgatcaaactgcgcggcgacagcgtggccgccaaagcctatgtgggcgggcag
aagctggacgcgctcgacgaggaaggcttctgcgacacccacgacttgggttttctcgtc
gacgacgaaatcgtcatccttggccggcaggacgaggtgttcattgtctacggagaaaac
agattcccctacgacatcgagttcatcattcgcagggaatccgagcagcaccggaccaag
gtcgcatgtttcggggtgaacgaacgcgtcgtggttgtgttggagagccaattggacagc
atcatcgacgaggccgaagccgaccgactgagatgtcaagtcgttgccgcgactgggctg
cagttggatgaactgatcacggttcggcgcggcgcgattcccaccaccaccagcggcaag
ctcaaacgacgcgccgtcgcgcaggcttatcgagacggcacactgccccgtcttgccacc
cacgcgtggacggcggatcccgatagtgctcccaaaacgacccggtccagcctggagggc
gcccgctga

DBGET integrated database retrieval system