KEGG   Mycobacterium canettii CIPT 140070017: BN45_10143Help
Entry
BN45_10143        CDS       T02422                                 

Gene name
treS
Definition
(GenBank) Trehalose synthase TreS
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mcz  Mycobacterium canettii CIPT 140070017
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN45_10143 (treS)
Enzymes [BR:mcz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BN45_10143 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BN45_10143 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
153727..155532
Genome map
AA seq 601 aa AA seqDB search
MNEAEHSVEHPPVQGSHVEGGVVEHPDAKDFGSAAALPADPTWFKHAVFYEVLVRAFFDA
SADGSGDLRGLIDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIRDFYKVLPEFGTVDDFV
ALVDAAHRRGIRIITDLVMNHTSESHPWFQESRRDPDGPYGDYYVWSDTSERYTDARIIF
VDTEESNWSFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMIDVIRFWLGLGIDGFRLDAV
PYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPGDVVEYFGDPNTGGD
ECHMAFHFPLMPRIFMAVRRESRFPISEIIAQTPPIPDMAQWGIFLRNHDELTLEMVTDE
ERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELFTALLLSLPGSPVLYYGDEIGM
GDVIWLGDRDGVRIPMQWTPDRNAGFSTANPGRLYLPPSQDPVYGYQAVNVEAQRDTSTS
LLNFTRTMLAVRRRHPAFAVGAFQELGGSNPSVLAYVRQVAGDDGDTVLCVNNLSRFPQP
IELDLQQWTNYTPVELTGHVEFPRIGQVPYLLTLPGHGFYWFQLTTHEVGAPPACGGERR
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggcagaacacagcgtcgagcaccctccggtgcagggcagtcacgtcgaaggc
ggtgtggtcgagcatccggatgccaaggacttcggcagcgccgccgccctgcccgccgat
ccgacctggttcaagcacgccgtcttctacgaggtgctggtccgggcgttcttcgacgcc
agcgcggacggttccggcgatctgcgtggactcatcgatcgcctcgactacctgcagtgg
cttggcatcgactgcatctggttgccgccgttctacgactcgccgctgcgcgacggcggt
tacgacattcgcgacttctacaaggtgctgcccgaattcggcaccgtcgacgatttcgtc
gccctagtcgacgccgctcaccggcgaggcatccgcatcatcaccgacctggtgatgaat
cacacctcggagtcgcacccctggtttcaggagtcccgccgcgacccagacggaccatac
ggcgactattacgtgtggagcgacaccagcgagcgctacaccgacgcccggatcatcttc
gtcgacaccgaagagtcgaactggtcattcgacccggtccgccgacagttctactggcac
cgattcttctcccaccaaccggatctgaactacgacaaccccgccgtgcaagaggcgatg
atcgacgtcatccgcttttggctcggcttgggcatcgacgggtttcggttggacgcggtg
ccctatctctttgaacgtgagggcaccaactgcgagaacctgccggaaacacacgctttt
ctcaagcgagtccgcaaggtggtggacgacgaattccccggccgggtgctgctagccgaa
gccaatcagtggccgggcgatgtcgtggagtatttcggcgatcccaacaccggtggcgac
gaatgccacatggccttccacttcccgctgatgccgcgcatcttcatggccgtgcgccgg
gagtcacgttttccgatctcggagatcatcgcccagaccccaccaatccctgacatggcg
caatgggggatatttctgcgcaaccacgacgagctgacgttagaaatggtcaccgacgaa
gagcgcgactacatgtacgccgagtacgccaaggatccacggatgaaggcgaatgtcgga
atccgtcgtcggctcgcgccgctgcttgacaacgaccgcaaccagatcgagctgttcacc
gcgctgctgctgtcgctgcccggctcgccggtcctctactacggcgacgagatcgggatg
ggcgacgtgatctggttgggtgatcgcgacggcgtgcgcatcccgatgcagtggacaccg
gaccgcaacgcgggcttctccaccgccaacccgggtcggctgtacctgccgcccagccag
gacccggtttacgggtatcaggccgtcaacgtcgaggcgcaacgcgacacctcgacgtcg
ctgctcaacttcactcgcaccatgctggccgtgcgtcgccgacaccccgcgtttgcggtc
ggcgcattccaggaattgggcgggtccaacccgtcggtgctggcctacgtgcgtcaggtg
gccggcgatgacggcgacaccgtgctctgtgtcaacaacctgtcgcgattcccgcagccc
atcgaattggacttacagcaatggaccaactacacgccggtcgagctgaccgggcacgtg
gagtttccacgcatcggccaggtgccctatctgctgacgctgccaggacacgggttctac
tggttccagttgaccacacatgaggtgggggcacctcccgcttgcgggggagagcggcgc
ctatga

DBGET integrated database retrieval system