KEGG   Musca domestica (house fly): 101888197Help
Entry
101888197         CDS       T03448                                 

Definition
(RefSeq) putative aldehyde dehydrogenase family 7 member A1 homolog
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
mde  Musca domestica (house fly)
Pathway
mde00010  Glycolysis / Gluconeogenesis
mde00053  Ascorbate and aldarate metabolism
mde00071  Fatty acid degradation
mde00260  Glycine, serine and threonine metabolism
mde00280  Valine, leucine and isoleucine degradation
mde00310  Lysine degradation
mde00330  Arginine and proline metabolism
mde00340  Histidine metabolism
mde00380  Tryptophan metabolism
mde00410  beta-Alanine metabolism
mde00561  Glycerolipid metabolism
mde00620  Pyruvate metabolism
mde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101888197
   00053 Ascorbate and aldarate metabolism
    101888197
   00620 Pyruvate metabolism
    101888197
  Lipid metabolism
   00071 Fatty acid degradation
    101888197
   00561 Glycerolipid metabolism
    101888197
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101888197
   00280 Valine, leucine and isoleucine degradation
    101888197
   00310 Lysine degradation
    101888197
   00330 Arginine and proline metabolism
    101888197
   00340 Histidine metabolism
    101888197
   00380 Tryptophan metabolism
    101888197
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101888197
Enzymes [BR:mde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101888197
    1.2.1.8  betaine-aldehyde dehydrogenase
     101888197
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     101888197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Arena_nucleocap
Motif
Other DBs
NCBI-GeneID: 101888197
NCBI-ProteinID: XP_005185627
UniProt: T1PE95
LinkDB All DBs
Position
Unknown
AA seq 546 aa AA seqDB search
MSQLFRAVSLLKNAPLHQAQRVASLHLSSALKANSYLIDSPEYAFLKDVGLERENPGVFT
GSWKGSGEVVTSIDPGTGKAIASVRSGTVQEMEESIKVGVEAYKEWCQVPAPVRGEIVRQ
IGDELRKYKEPLGKLVSLEVGKIYSEGQGEVQEFIDICDYAVGLSRIYAGQMINSERAEH
TILEAWRPLGLVGVISAYNFPNAVFGWNAAIALTCGNSVLWKGAPTTSLVSVATTKIVAD
VLKRNNLPPITTLCQGGADVGKKLVSDKRVKLVSFTGSCQTGRDVGVEVQKRFGKVILEL
GGNNALVINEDANLKMALDAALFGCIGTSGQRCTTTRRIIVHEKLYDQFVKELCGKYKQV
LSRIGHQLDANTLVGPVHSQLNIDGYKNTIADAVKLGGKVAFGGNVINREGFFVEPTVIT
GLAHDAPVVHRETFAPIVYVLKTKSVEEAIEWNNEVDQGLSSAIFTENMSKAFKWIGAQG
SDCGIVNINTTTNGAEIGGAFGGEKHTGGGRESGSDAWKQYCKRATITVNHSGELACAQG
VVFNVE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacttttccgtgccgttagtttactgaaaaatgctcctttgcatcaggcacaa
agagtagcatctctccaccttagctctgctctgaaggccaatagttatttaattgattct
ccagagtacgctttccttaaggatgttgggttggaacgtgaaaatcccggtgtattcact
ggctcatggaaaggttcaggagaagttgtcacttcgattgatcctggtaccggtaaagca
attgccagtgttcgctctggcacagttcaagaaatggaagaatccataaaggtgggagtg
gaagcctacaaagaatggtgtcaagtgcctgctccagttagaggcgaaattgtacgacaa
attggtgatgaattacgcaaatacaaggaacctttgggtaaattggtaagcttggaagtt
ggtaagatctacagcgaaggtcaaggtgaagttcaagaattcattgatatctgtgattat
gctgtgggtttgtcacgcatctatgctggacaaatgattaattcggaaagagctgagcac
acaattttggaagcatggcgtccattgggtttggtgggcgttatttcggcctataatttc
cccaatgccgtttttggctggaatgctgccattgccttgacctgcggcaacagtgttttg
tggaagggagccccaaccacctccttagtttcggtggccaccactaaaattgtcgccgat
gtcttgaaacgcaataacttgcctccaatcacaacattgtgccaaggtggcgcagatgtt
ggcaagaaattggttagcgataaacgcgtcaaattggtttcctttaccggcagctgtcaa
acaggacgcgatgttggagtggaggtacaaaaacgcttcggcaaagtcattttggaattg
ggcggtaacaatgccttggtaattaatgaagatgccaatttgaaaatggctttggatgct
gccctgttcggttgcattggcacatctggacaacgttgtactaccaccagacgtattatt
gtccatgagaagctctatgatcaattcgtcaaggaattatgtggcaaatataagcaggtt
ttgtcacgcattggtcatcaattggatgcaaataccctagtgggtcctgttcattcccaa
ctaaatattgatggttataagaataccattgctgatgctgttaaattgggcggtaaagtg
gcctttggcggtaatgttattaaccgtgaaggattcttcgtcgaacccactgttattacc
ggtttggcacatgatgctcctgtcgtgcatcgtgaaactttcgctcccattgtctatgta
ttgaaaaccaaatctgttgaagaagctattgaatggaataacgaagtcgatcaaggtctc
tcgtcggccatcttcaccgaaaacatgtcgaaggcattcaaatggattggcgcccaaggt
tccgattgtggcattgtcaacattaacaccaccacaaatggtgctgaaattggaggagcc
ttcggtggtgagaaacacactggcggtggtcgtgagtctggctcagatgcctggaaacag
tactgtaaacgtgccaccataaccgtcaatcattctggagaattagcttgtgcccaaggt
gttgttttcaatgtcgagtaa

DBGET integrated database retrieval system