KEGG   Musca domestica (house fly): 101894917Help
Entry
101894917         CDS       T03448                                 

Definition
(RefSeq) histone-lysine N-methyltransferase Su(var)3-9 isoform X1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mde  Musca domestica (house fly)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mde00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101894917
Enzymes [BR:mde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101894917
Chromosome [BR:mde03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101894917
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101894917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 642 aa AA seqDB search
MSTAEAQIGLNTNLQQQDLKNLDVSNLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAI
SGVQTVRFKNELERNITIKLERISQQRIQALLASPKLLREFERQQEAKRRQRLRQRQQQQ
VQQRRVRQLKQQQQEKQSTMTRSSSLDSLLTRSERGPSVSPSSGYESLNDNASICSADSL
YMKSPPKSLVVLLTKSSLVEEALQHTIQNKRRRNSCETPSHTPKKQKHEYVVENIESIEC
INAEPVFYVKWLNYPKSQNTWERLSNVSECVLLDGFIQSQMYLHEDVIPDIREKLLQKIQ
DEQITLQPHELNMEELDNFDPMVVKIDLILLAQFIKARSRSQREPEKIRERLIKSMLMEQ
CSVKRKQQLASLQEWEERMNLIESVSPIRVENNVDLETLDPNFQYINANFCGKGVEIQIS
PKMGCKCEDVCAPSTKCCARLADSYFAYDKNGRLRIYPGEAIYECNEACACSEDCPNRVI
QRGRHNSLCLFKTSNGRGWGVRTEKALRKGEFVGEYVGEIITSEEADERGTQYDAIGRTY
LFDLDYNTNAESMYTIDAALHGNVCHFFNHSCDPNLAVFPFWVDNLDINMPRLAFFTLRP
IKPGEELTFDYIRGDEGEYENLSNAEKVSCRCGAEKCRKVLF
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagcggaagctcagattggtttaaatacaaatttgcaacagcaggatctaaaa
aatttggatgtcagcaatttgacaccattgtcgcctgaggtaatttcacgtcaagctact
atcaatattggtaccattggtcatgtagctcacggtaaatcaacagtggtcaaagccatt
tcgggtgtacagactgttcgtttcaagaacgaattggaaagaaatattaccattaaattg
gaacgcataagtcagcaacgcatacaagctctgctagcatctccaaaattattacgcgag
ttcgaaaggcaacaagaggcaaaacgccggcaacgactgagacaaagacaacaacagcaa
gtgcaacaacgtagagtaaggcaattaaaacaacaacaacaagaaaaacaaagtacaatg
acacgttcatcatctctggatagtttactgacgcgctcggaacgtggaccttccgttagt
cccagcagtggctatgaaagccttaacgataatgcatccatctgtagtgcggattctttg
tatatgaaatctccacccaaatccttagttgttttactaaccaaatccagtctcgtagaa
gaagccttgcagcacaccatacagaataaacgacgtcgcaattcctgcgaaactccatct
catacgccgaaaaagcaaaaacacgaatatgttgtcgaaaacattgagagcattgaatgt
ataaatgccgagccagtattctatgtcaaatggctgaattacccgaaatcacaaaatacc
tgggaacgactgagcaatgtcagcgaatgtgttctgctcgatggcttcattcaaagtcag
atgtatctacatgaggatgtcatacctgatatacgtgagaaactactgcagaaaatccaa
gacgagcagattacgctgcagccccatgaattaaatatggaagaattggataattttgat
cccatggttgttaaaatcgatttaatactgttggcccagtttataaaggctcgttctcgc
agccaacgtgaacccgagaaaatacgtgaacgtctcattaaatctatgttaatggaacag
tgttccgtaaaacgtaaacaacaattggcctccttacaggaatgggaggaacgcatgaat
ctgattgagtcagtatccccaatacgagtggaaaataatgtcgatctagagacactggat
cccaatttccagtacataaatgccaacttttgtggcaagggtgttgaaattcagatcagc
cccaaaatgggttgcaagtgtgaggatgtttgtgcaccctcaaccaagtgctgtgcacgt
ttggccgacagctattttgcctatgacaaaaacggccgtctacgcatatatccgggtgaa
gcaatctatgagtgtaatgaggcatgtgcctgttccgaagactgtccgaatcgcgtcatt
caaagaggacgccacaactccctgtgtctgttcaagacatccaacggtcgtggttggggt
gttcgaacggaaaaagccctgcgtaagggtgaatttgtgggagaatatgtgggcgaaata
atcacctctgaggaggctgatgaacgtggcacccaatacgatgcaattggacgtacttac
ctctttgatttggactacaacacgaatgcggaaagcatgtacaccattgacgcagccctg
catggcaatgtatgtcactttttcaatcattcttgtgatcccaatttggccgtttttcca
ttttgggtggacaatttggacattaacatgccccgcctggcatttttcacattgcgaccc
attaagccgggcgaagagctaacctttgattatattcgtggcgacgagggcgaatatgag
aatctttcaaatgccgaaaaagttagttgccgctgtggagctgaaaaatgccgcaaagtt
ttgttttaa

DBGET integrated database retrieval system