KEGG   Musca domestica (house fly): 101899383Help
Entry
101899383         CDS       T03448                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
mde  Musca domestica (house fly)
Pathway
mde00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mde00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101899383
Enzymes [BR:mde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101899383
Chromosome and associated proteins [BR:mde03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101899383
   HMT complexes
    COMPASS/SET1 complex
     101899383
    COMPASS/SET1 complex (yeast)
     101899383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 101899383
NCBI-ProteinID: XP_005190013
UniProt: A0A1I8MGU5
LinkDB All DBs
Position
Unknown
AA seq 1818 aa AA seqDB search
MYDRMESSYSRMPPTHPTSNGAVSAGEQQTCGGTNTQKIPRNFKLLSDPALTKGVIKLYR
FDGIVPNDPTYPPVMPRDPRNPVVRLRARPVEPMVLAVPRLKIDENYVGNPPPIEVTITN
LNDNIDKQFLSRMLEKCGPYDDITIYHHPTTNKHLGVARIVFENVKASRLCVEKYDQKSV
MGKIISVFHDPFGSICKQTIDDLTSTKPKAPPPSINTEAQVADVATASLTSGYIDHHHQE
YIPHDGFEVGYKHSYRSERDYERYRDRYDDDRSYRDKRGQRGDSRDKYTIGRYEKDRPQH
HHHYTSKRDRSREHSRDRISGGRRDRDRDKEKCRDYEMSRERDRDRRDRERDYRDRDHRD
RSDERDRTDKMRGTDKYGSSRYVRDYGESTSASSSHYASSSGVIYYPLQTNTIPPSSSHL
MANSIPTTYDYHAYSYNADSQTSAHIWHGGGVRTWPTLPSQQPPPHQTQPPLPPPPPDAT
PDWDEPEPPPPGGYSSNDENNSQTDQKQRIKKVSSSEKKLLGTESKLDPVTDSGTVDLDT
RIALMFKGKSFGNAPPFLQMDSSDSEAEKAGLETKIDVDEGEVNSDSNGKVLKSQSNIMQ
IKDDKSANTSKKLRVIQQGASDISSSDDEILLNKCSYSPIETTLKKKEVDGMSLSSLSSN
DDPRNVHVKDNHSLIVSTGSGTTAAVPSVSYVYASTASTNPYYYPGNGYAPYSSTDVAPP
AAQYFPNPAYIQSSYLPGIGPALSAFGTASGAYSDAYGDAYKSFYRSDGYTNYVGAHTAV
YEEDPYKRHIEEVVKKVSDELKQILKRDFNKKMIENTAFKNFETWWDEQIQKNRRYKSEV
EKLTEKPSLVTSLASTSIPTTTRIDKPPDINQLINSHRDISDFSSNYPALGLRAAIPKLP
SFRRIRKQNSPKSQKTDEEKRLSDQEEMVQGSDSEKEDSNLSSGTLQQIVSRVKETKSRH
DSAIKSKSNVSRTKRKGSSSSFFSSSSSSEGDNDDEDDDDQDGSSGDGDDSASDDDLSSI
SDINDKETKRDKEKTNKLAVVKSAIYSDTEDEDKDSRVEKITKEDSKALVSDLEDISKDT
SFSIGEDLQETMVDQRGNVEDSKQKSLEKVVDAVSEEKEILKDKKNAQLEHQITQQRKKS
VFEYDRIYSDSDEEREYQEKRRRNTEYMAQIEREFLEEQQRKMVEEEQNKEIRDSIQPST
RGIEINRSYSAASRKSLDMSDTLDFNKVPPTPGGKLVVEPIFSNTSSNKNKPTFKNKKEK
TFTSNKVNDSKARKDTAMKATDSQSTTTAVISKRNDDICANSNVEVDLQAKMVTSSDSNG
YSTENNTKTSQVEPVAMCVNATEETLEEIHLKDTLLPSKCSNQLDEDNETVKMSPASSDG
GSSQASQASQVALEHCYSLPPQADIPKPKISSTVETARKTQQYLAHDHGGYTTPPAASSC
MLSEVSSPQIATQACSIAKPGPGRPRKDAIRSKKKDDRALNKTEQNLEKTDMVFKNSFDK
ALAVFEPREMFKPRETAEEMMVLYEFLTRGIDSEDIQYIRRCYEIHLQEDTYGFLLNNTH
WVDHCVTDRSFVPPPNKKRKKDDELKVHKTGCARTEGFYKLDVRDKAKHKYHHAKANVEN
AQTWDRTDDQQATQHNKQVSKMQGISREARSNQRRLLTAFGSIGESELLKFNQLKFRKKQ
LKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPIVADLRETKYEAIGIGSSYLFRIDM
ETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFPLE
DEKIPCLCGAQGCRGTLN
NT seq 5457 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatcgaatggaaagcagttactcgcgaatgcctcccacacatccaacaagtaat
ggtgcggttagtgctggcgaacagcagacgtgtggaggaacaaacacccaaaagattccg
cgaaactttaagctactttcggacccagccttaacaaagggtgttattaaactctatcgg
ttcgatggaatcgttcctaatgacccgacatatcctccggttatgccgagggatcctcga
aacccggtagttcgtctgagagctagacccgtagaacctatggttttggcagttccaagg
ttaaagatagatgaaaattatgtcggtaatcctccaccgatcgaagtgaccattactaat
ctcaatgacaacattgataaacagttcttatcccgaatgttagaaaaatgcggtccgtac
gatgatattaccatctatcatcatcctacaaccaacaagcatcttggagtggctcgtata
gtctttgaaaacgtaaaggcatcacgattgtgcgttgagaaatacgaccagaaatctgtg
atgggaaagattatcagcgtgtttcacgatccgtttggcagtatctgtaaacaaactatc
gatgatttgacgtcaacaaaaccgaaagctccgccaccttcaataaatacagaagcacaa
gttgctgatgttgctacagcgtctcttacaagtggatacattgaccaccaccatcaagaa
tatattccacatgacggtttcgaagttggttataaacattcatatcgttctgaacgtgat
tatgagcgttatcgtgatcgatacgacgatgacagatcttatcgagataagcgtggacag
agaggtgatagcagggacaaatataccataggcagatatgaaaaagatcgcccacagcac
catcatcattacactagcaaaagggatcgatctagggagcacagtcgtgatcgaatcagt
ggaggaaggcgagacagggatcgagacaaagagaaatgcagggattacgaaatgtcgagg
gagcgtgatagagatcgaagagatcgtgaacgggattatcgtgatagagaccaccgagat
cggtcagatgagagagaccgtacggataaaatgcgaggaactgataaatatggcagctca
aggtacgtacgggactatggagaatccacttctgcttccagttcacattatgcctcatct
agtggtgttatatactatcctctacaaaccaacacaattccaccctcttcctcccattta
atggctaactccattcctacaacatatgattatcatgcatatagttacaatgcagatagt
caaacttctgcccatatttggcatggtggtggtgttcggacgtggccaactttaccaagt
caacaacctccgccacaccaaactcagcctcccctgccaccgcctccgccagatgccacc
cccgattgggatgaaccggaaccaccacctccaggggggtactctagtaacgatgagaac
aatagtcaaactgatcagaagcaacgaatcaaaaaggtttcttcatctgaaaagaagcta
ttagggactgaaagcaaattggatccagtaacagattcgggtacagttgatttggatacg
cggattgcacttatgttcaaaggaaagtcatttggtaatgcacccccctttctacagatg
gatagcagcgattctgaagctgaaaaggctggattggagacgaaaattgatgtagacgaa
ggggaagtgaattccgactcaaatggtaaagtattgaaaagtcagtcgaacataatgcaa
atcaaggatgataaatcggcaaacacatccaaaaaattgagagtcatccaacaaggagcc
agtgatatatcgtcaagcgatgacgaaatactacttaataaatgttcgtacagccctata
gagacgacacttaagaaaaaagaagtagatggaatgtcgctctcaagtttgtcctcaaac
gatgatccaagaaacgttcatgtaaaggacaatcatagtttaatagtttccacaggaagt
ggtacaaccgctgctgttccatcagtttcgtatgtatacgcgtcaactgcttcaacgaat
ccgtactactatccaggaaacggttatgcaccatattcttcaacagatgtcgccccaccg
gcagcacaatattttcctaaccctgcgtacatacaatcgtcatatttacctggtatcgga
ccagccttatctgcattcggtactgcgtcaggtgcttatagcgatgcgtatggcgatgcc
tataaatcattttatcgttctgatggctacacgaactatgttggagcacatacagcggta
tatgaagaagatccctataagcgacacatagaagaagtggtcaaaaaagtaagcgatgaa
ctcaaacaaattttaaaaagagatttcaataagaagatgattgaaaatacagcgtttaaa
aattttgaaacttggtgggacgaacaaattcagaagaatcgaagatataaaagcgaagta
gaaaaactgactgaaaaaccttccctagtcactagccttgcgtcaacaagcatacccact
acaacgcgaatagataaaccacctgacatcaatcagttgataaatagccatcgggacata
tctgacttcagttcaaattaccctgcattaggcttacgtgctgcgattcctaaactgccg
tcctttcgacgaatacgcaaacaaaatagtccaaaatctcagaaaacagatgaggagaaa
cgtttgagtgatcaagaagaaatggtgcaaggctcagattcagaaaaagaggattccaac
cttagctctggaactttgcaacagattgtaagtcgagtaaaggaaacaaaaagtcgccat
gactctgcgatcaagagcaaatcaaatgtttcccgtactaagcgaaagggaagttcgtcc
agtttcttttcaagttcatcgtcaagcgaaggagataatgacgacgaagacgatgacgat
caggatggaagttcaggtgatggcgacgacagcgcaagtgatgatgatttaagttcaata
tcggatataaatgataaggaaactaagcgagataaagaaaaaacaaacaagttagctgtt
gtaaaaagcgcgatatactcggacactgaggatgaagataaagatagccgggtggaaaaa
attaccaaggaagattctaaagctttggtttcagatttggaagatattagcaaagacacc
tcatttagtataggagaagatctgcaagaaactatggtagaccaaaggggtaatgttgaa
gattccaagcagaaatccttagaaaaagttgtcgatgccgtttctgaagagaaagaaatc
ttaaaagataagaaaaatgcgcagttggaacatcaaataactcaacaacgaaagaaatca
gtttttgaatacgatcgtatttatagcgattcggacgaggaacgtgaatatcaagagaaa
cgacgacgtaataccgaatatatggcgcaaattgaacgagagttcctagaggaacaacaa
cgtaaaatggtcgaagaggaacaaaacaaagaaataagagattcaattcaaccttcgact
aggggtatagagataaatcggtcttattctgcagcatccagaaagtcgttagacatgtct
gacacactcgattttaataaagttccccccacccctggaggaaagttagtcgtagagcct
atatttagcaacacatcgtccaacaaaaataaacctacgttcaaaaataaaaaagaaaag
acttttacaagtaataaagtaaacgactcaaaggccagaaaggatactgcgatgaaagca
actgactcccaaagcacaacaactgctgtaatttctaaaagaaatgacgatatttgtgca
aattcaaatgtagaagtagatttgcaagccaagatggtcacgtcaagcgattctaatggt
tattcgactgaaaataacacaaaaacaagtcaagtagagccagttgcaatgtgcgtaaat
gctacggaagaaacactagaagagattcatctaaaagatacattgttgccatcgaaatgt
tctaaccaacttgacgaggataatgaaacagtaaaaatgtctcctgcttcctccgacgga
ggttccagccaagctagtcaggctagtcaggtggcgctggagcattgctactcattaccc
ccacaagcggatatcccaaaaccaaagatttcgtcgacagtcgaaactgctcgaaagaca
cagcaatatttggcacacgatcatggaggttacacaacgccccctgctgcatcatcttgc
atgttgagcgaagtttcttcaccacaaattgccacccaagcatgttctatagcgaaacct
ggcccaggaagaccacgaaaggatgctattcgaagcaagaagaaagatgatcgggcactt
aataaaactgagcaaaacctggagaagacggacatggtttttaaaaacagctttgacaaa
gcattggcggtctttgagcctcgagaaatgttcaaacctcgcgaaaccgctgaagaaatg
atggtgttgtatgaatttttgactagaggcatagattcggaggatatacagtacatccgg
cgttgttatgaaattcatctccaagaagacacgtatggttttttgctaaacaacactcac
tgggtagaccattgtgttacggacagatcgtttgttcctccgccgaataaaaagcgcaaa
aaagatgatgagctaaaagttcataagactggttgtgccagaaccgaaggtttctacaaa
ctggatgttcgtgataaagccaaacacaaatatcaccatgccaaggctaatgtagaaaat
gcacagacctgggatagaactgatgaccaacaagcaacccaacacaataagcaagtatcg
aaaatgcagggcatttctcgagaagcgcgatctaatcaacgacgtttgcttactgcattt
ggttcaattggcgagtccgaattgctgaaatttaatcagctgaagttccgcaaaaaacag
cttaaatttgctaaatcggctatacatgactggggcctgttcgctatggaaccgattgct
gctgatgaaatggtaatcgaatacgttggacaaatgattcggcctattgtggctgactta
cgtgaaaccaaatatgaagccattggcatagggagttcgtatttgttccgcatagacatg
gagactatcatcgacgctacgaagtgtggtaacctagctcgtttcattaaccacagctgc
aatccgaattgttacgcaaaagtcatcacaattgaatccgaaaagaaaattgtaatatat
tccaaacaaccgataggaataaatgaggaaataacatatgattacaagtttcctttagag
gatgagaaaataccctgtctgtgtggtgcgcaaggttgcagaggaacccttaattaa

DBGET integrated database retrieval system