KEGG   Musca domestica (house fly): 109613440Help
Entry
109613440         CDS       T03448                                 

Definition
(RefSeq) trypsin alpha-4
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mde  Musca domestica (house fly)
Pathway
mde04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mde00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109613440
Enzymes [BR:mde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109613440
Peptidases [BR:mde01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109613440
Exosome [BR:mde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109613440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109613440
NCBI-ProteinID: XP_019893807
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MFKFVILLSALACALGATVPEGMLPQLDGRIVGGAATTISSFPWQISLQRSGSHSCGGSV
YSSKIIVTAAHCLQSVSASVLKVRAGSSYWNSGGTLVSVAAFKNHEGYNSKTMVNDIAVI
RLSSSLTMSSTIKAIGLASTAPANGASASVSGWGTQTSGSSSIPSQLRYVDVKIVGRTQC
ASSTYGYGSEIKASMICAYTVGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYTNYPGVYA
DVAALRSWVVSAASSV
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagttcgtaattttattgtcggctcttgcctgcgctttgggcgccaccgtacct
gagggtatgttgccccaattggatggacgcattgttggcggtgctgctaccaccatcagc
tccttcccctggcaaatctctttgcaacgttccggctcccactcctgcggtggttccgtc
tactctagcaagatcattgtcaccgctgcccattgcttgcaatccgtttctgcttccgtc
ttgaaggttcgtgctggctccagctactggaactctggcggtaccttggtttccgttgcc
gctttcaagaaccacgaaggttacaactccaagaccatggttaacgatattgctgtcatc
cgtttgtcctcctccttgaccatgagctccaccatcaaggctattggtttggcctccacc
gctcccgctaatggtgcttctgcctccgtctctggttggggtacccaaacttctggctcc
tcctccatccccagccaattgcgttatgtcgatgttaagattgttggccgcacccaatgt
gcctcctccacctatggttatggctctgaaatcaaggctagcatgatctgtgcctacact
gttggtaaggatgcttgccaaggtgattccggtggcccattggtctctggtggtgtcttg
gttggtgttgtctcctggggttatggctgtgcctacaccaactaccctggtgtctatgct
gatgttgctgccctccgctcctgggttgttagcgctgcttcatctgtttaa

DBGET integrated database retrieval system