KEGG   Methylomonas sp. DH-1: AYM39_19655Help
Entry
AYM39_19655       CDS       T04396                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mdh  Methylomonas sp. DH-1
Pathway
mdh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mdh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AYM39_19655
Enzymes [BR:mdh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AYM39_19655
Transporters [BR:mdh02000]
 Other Transporters
  Pores ion channels [TC:1]
   AYM39_19655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N GST_N_2 GST_C_3 GST_C GST_N_4
Motif
Other DBs
NCBI-ProteinID: ANE57175
UniProt: A0A172UCX8
LinkDB All DBs
Position
4423050..4423700
Genome map
AA seq 216 aa AA seqDB search
MITLYGIAISNYYNKVKLALMEKEIAFVEEAVRPSQNEAVLKRSPLGKVPFIKTPEGYLS
ESQAILEYLEDAFPEHPLFPGDAFERGKCREFIQHIELNVELIARRLYAEALFGGSVSQE
TKDEVRQKLDTGLTGLAKLLKLAPYALGDSFTAADVVAWPHLQLVGFATQKIYGENLVNS
HIPGIESYMQLIESRPHAQTVAADRATALAAFFANQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgattactttatacggcatagcaatcagcaactattacaacaaagtcaaactggccttg
atggaaaaggaaatcgccttcgtcgaagaagcggtgcgcccgagccaaaacgaagcggtg
ttgaaacggtcgccgctgggcaaagttccgttcatcaaaaccccggaaggctatttgtcc
gaatcgcaagcgatattggaatacctggaagatgcgtttcctgaacacccgctgtttcct
ggcgacgctttcgaacgcggtaaatgccgcgagtttatccagcatatcgaactgaacgtt
gaactgattgcccgccgcctgtatgccgaagcgcttttcggcggcagcgtgtcgcaagaa
accaaagacgaagtccggcaaaaactcgacaccggtttgaccggcttggccaaattgttg
aagctggcgccttacgcgctgggcgattcgtttaccgccgccgacgtcgtcgcctggccg
catctgcaactggtcggtttcgccacccaaaaaatttacggcgaaaacttggttaacagc
catatccccggcatcgaaagctatatgcaactgatcgaaagccggcctcatgcgcaaacc
gtagccgccgaccgcgctacggcgctggcagcgtttttcgccaaccagtaa

DBGET integrated database retrieval system