KEGG   Methylomonas sp. DH-1: AYM39_19970Help
Entry
AYM39_19970       CDS       T04396                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mdh  Methylomonas sp. DH-1
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mdh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AYM39_19970
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AYM39_19970
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AYM39_19970
Enzymes [BR:mdh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AYM39_19970
Peptidoglycan biosynthesis and degradation proteins [BR:mdh01011]
 Precursor biosynthesis
  Amino acid ligase
   AYM39_19970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4496586..4497536
Genome map
AA seq 316 aa AA seqDB search
MKPLRITNPAEFGNVAVMMGGSAAEREISLNSGNAVYQALTAQGIAATAIDVTGSPIDAL
AGRQFDRVFNIIHGRGGEDGVLQAVLATLGLPYTGSGVLASALAMDKLRTKLCWQGAGLP
TPRWFLLHGEQDIDTCINALGFPVIVKPAQEGSSIGMSKAHNRDELAAALKTASQYRCDV
YAEQWIQGQEFTIGMLDGEALPAIRLETPHTFYDFDAKYRANTTQYHCPCGLSAEREREL
QALALRACQTVGVEGWGRVDAFIDDSGRMQLIEVNTVPGMTDHSLVPMAAKAVGVSFEEL
VWRILETSVAGTAGAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctttacggataaccaatcccgccgaattcggcaacgtggcggtgatgatgggc
ggctcggctgcggagcgggaaatatcgttgaacagcggcaatgcggtttaccaagcatta
accgcccaaggcatcgccgccaccgcgatcgacgtgaccggcagtccaatcgacgcgctg
gcaggtcgccaattcgaccgcgtgttcaacatcatccacggtcgcggcggcgaagacggc
gtgttgcaggcagtattggcgacgctgggcctgccttacaccggctccggcgtgctggct
tcggcgctggcgatggataagttgcgcaccaagctgtgctggcaaggcgccggcctgccg
acgccgcgttggtttttgttgcatggcgaacaggatatcgacacctgcatcaatgcgctg
ggttttccggtcatcgtcaagccggctcaggaaggctccagcatcggcatgagcaaagcc
cataaccgcgacgagttggccgccgcgttgaaaaccgccagccagtaccgctgcgacgtt
tatgccgagcaatggatccagggccaggaatttacgataggcatgctggacggcgaagcg
ctgccggcgatccggctggaaacgccgcataccttttacgacttcgacgccaaataccgc
gccaataccacgcaataccattgcccgtgcggtttgagcgccgagcgcgagcgcgaattg
caggctttggcgctcagagcctgccagaccgtcggcgtcgaaggctggggccgggtcgat
gcctttatcgacgatagcggccgcatgcaattgatcgaagtcaataccgtgcccggcatg
accgaccatagtctggtgccaatggcggctaaagcggttggcgtcagcttcgaggaattg
gtgtggcggatattggagaccagcgtggcgggaacggcgggtgcggcttag

DBGET integrated database retrieval system