KEGG   Methylobacterium extorquens DM4: METDI5018Help
Entry
METDI5018         CDS       T00947                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    METDI5018
Enzymes [BR:mdi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     METDI5018
Transporters [BR:mdi02000]
 Other Transporters
  Pores ion channels [TC:1]
   METDI5018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: CAX26633
UniProt: C7CJD0
LinkDB All DBs
Position
complement(4922506..4923147)
Genome map
AA seq 213 aa AA seqDB search
MSDDLVFYTNPMSRGRIVRWMLEEVGAPYRTEILGYGSSMKAPAYRAINPMGKVPALRHG
ATVVTECPAILAYLADAFPQAGLAPEPSHHDRGPYYRWLFFCAGPLEAAVTNGVLKVSVP
DDPRMQGMVGYGSLETALDTLEGAVSGVEFVAGDRFSAADLYVAAHLGWGMQFGTIPKRP
AFEAYAGRHLAREAAARARAIDDALLAEAQAAS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgatctcgtcttctacaccaacccgatgtcccgcggccggatcgtccgctgg
atgctggaggaggtcggcgccccctaccgcaccgagatcctcggctacggcagttccatg
aaggcgccggcctaccgggcgatcaacccgatggggaaggtgccggcgctgcgccacggc
gcgacggtggtgaccgagtgccccgcgatcctcgcctatctcgccgacgccttcccgcag
gccgggctcgcccctgagcctagccaccacgaccgcggcccctattaccgctggctgttc
ttctgcgccgggccccttgaggcggcagtgacgaacggcgtgctcaaggtgagcgtcccc
gacgatccgcgcatgcagggcatggtcggctacggcagcctggagacggccctcgacacg
ctcgaaggcgccgtttccggcgtagagttcgtggcgggcgatcggttcagcgccgccgac
ctctacgtcgccgcgcatctcggctggggcatgcagttcggcacgattccgaagcgtccc
gccttcgaggcctatgccgggcgccacctcgcccgcgaggcggccgcgcgggcgcgggcg
atcgatgacgctttgctcgccgaagcgcaggcggcgtcatag

DBGET integrated database retrieval system