KEGG   Methylobacterium extorquens DM4: METDI5427Help
Entry
METDI5427         CDS       T00947                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu (EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
mdi  Methylobacterium extorquens DM4
Brite
Translation factors [BR:mdi03012]
 Eukaryotic Type
  Elongation factors
   METDI5427 (tuf)
 Prokaryotic Type
   METDI5427 (tuf)
Mitochondrial biogenesis [BR:mdi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    METDI5427 (tuf)
Exosome [BR:mdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   METDI5427 (tuf)
  Exosomal proteins of breast cancer cells
   METDI5427 (tuf)
  Exosomal proteins of colorectal cancer cells
   METDI5427 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5370320..5371510)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFSRTKPHCNIGTIGHVDHGKTSLTAAITKVLAESGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDEELLELVELEVRELLSKYDFPGDDIPITKGSALMALE
DKEPKIGKEAVLALMATVDEYIPQPERPIDMPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGESVEIVGIRPTTTTTVTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVVCKPGS
VKPHSKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVCTLPEGTEMVMPGDNVT
MDVVLIVPVAMEEKLRFAIREGGRTVGAGVVAAIND
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagttctcccgtaccaagccgcactgcaacatcggcacgatcgggcac
gtggatcacggcaagacgtcgctgacggcggcgatcacgaaggttctggcggagtcgggc
ggggcgaccttcacggcatacgaccagatcgacaaggcgccggaggagaaggcgcgcggc
atcacgatctcgaccgcccacgtcgagtacgagacgaccaaccgccactacgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggtgccgcccagatggac
ggcgcgatcctggtcgtgtccgccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgtcaggtcggcgtgccggcgctggtggtgttcctcaacaaggtcgacatg
gtcgatgacgaggagctgctggagctggtcgagctggaggtgcgcgagctcctctccaag
tacgacttccccggcgacgacatcccgatcaccaagggctcggccctgatggcgctcgag
gacaaggagcccaagatcggtaaggaagccgttctggcgctgatggcgacggtggacgag
tacatcccgcagccggagcgtccgatcgacatgccgttcctgatgccgatcgaggacgtg
ttctcgatctcgggccgcggcacggtggtgaccggtcgcgttgagcgcggcatcgtcaag
gtcggtgagtcggtggagatcgtcggcatccgtccgacgacgacgacgacggtgaccggc
gtcgagatgttccgcaagctgctcgaccagggtcaggcgggcgacaacgtcggcgtgctg
ctgcgtggcacgaagcgcgaggacgtggagcgcggccaggtcgtgtgcaagcctggttcg
gtgaagccgcactcgaagttcaaggccgaggcctacatcctgacgaaggaggagggcggc
cgccacacgccgttcttcaccaactaccgcccgcagttctacttccgcacgacggacgtg
accggcgtgtgcacgctgcccgagggcaccgagatggtgatgccgggcgacaacgtgacc
atggacgtggtgctgatcgtgccggtggccatggaagagaagctgcgcttcgccatccgc
gagggtggtcgcaccgtcggtgccggcgtcgtcgccgccatcaacgactga

DBGET integrated database retrieval system