KEGG   Malus domestica (apple): 103400721Help
Entry
103400721         CDS       T03194                                 

Gene name
HXK1
Definition
(RefSeq) hexokinase-1-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
mdm  Malus domestica (apple)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103400721 (HXK1)
   00051 Fructose and mannose metabolism
    103400721 (HXK1)
   00052 Galactose metabolism
    103400721 (HXK1)
   00500 Starch and sucrose metabolism
    103400721 (HXK1)
   00520 Amino sugar and nucleotide sugar metabolism
    103400721 (HXK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103400721 (HXK1)
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103400721 (HXK1)
Membrane trafficking [BR:mdm04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103400721 (HXK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
15
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALIVRHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDENGLFYALDLGGTNFRVLRVRLGGNEKR
VVKQEFDEVSIPPHLMTGTSEGLFDFIAEALAKFVATEGEGLHPAPSRQRELGFTFSFPV
WQTSIASGTLIRWTKGFNIEDAVEQDVVGELTKSMEKIGLDMRVTALVNDTIGTLAGGRY
HNQDVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ALDAESLNPGEQIFEKIISGMYLGEIVRRVLLKMAEEADFFGDVVPPKLKIPFILRTPEM
SAIHHDSSPDLKVVGSKLKDILEISNTSLKMRKVAVAVCDIVATRAARLSAAGMLGVLKK
LGRDTVKDGEKQKSMIAMDGGLYEHYTEFRTSMECTLKELLGDEVAEHISVEHSNDGSGI
GAALLAASHSQYLEVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtggcggtgggggcggctgtggtgtgcgcggcggcggtatgtgctgcggcg
gcgctgatcgtgcggcaccgcatgaagagctcgggaaggtgggcccgggcgatggcgatt
ctgagggagttggaggataagtgcgggacccccattgggaagctgagacaggtggctgac
gccatgactgtggaaatgcacgctggcctcgcatccgagggcggcagcaagctgaagatg
ctcatcagctacgtcgataacctccccactggggatgagaatgggctgttttatgcactg
gaccttggtgggacaaacttccgtgttctgcgtgtacggcttggtgggaacgaaaaacgt
gttgttaaacaagaatttgacgaagtttccattccaccgcatttgatgactggaacttca
gaaggattatttgattttattgccgaagcacttgcaaaatttgttgctacggaaggagaa
ggtttgcatcctgcacccagtagacaaagggagctgggttttaccttttcatttcctgtg
tggcaaacttcaattgcctcagggacccttattaggtggacaaaaggcttcaatattgag
gatgcggttgagcaagatgtggtaggagagctgaccaaatcaatggaaaaaattggactt
gatatgcgtgttacagctttggtaaatgatacaattggtacattagcaggaggtaggtac
cacaatcaggatgtcattgctgctgtgatattgggcactggaacaaatgctgcttatgtt
gaaagagcgcatgccattccaaaatggcatggtcttctacctaaatcaggagaaatggtt
atcaacatggagtggggtaactttcgctcatcacaccttccgctgacagaatacgatcaa
gcacttgatgctgagagtttaaaccctggagagcaaatcttcgagaagatcatttctggc
atgtatttaggggaaattgtgcgcagagtattgctcaagatggctgaagaagctgacttt
tttggtgatgttgtcccaccaaaactgaaaattccattcatactaaggactcctgaaatg
tctgccatacatcatgactcatctccagatctgaaagtggtcgggagcaaactcaaggac
atcctcgagatctccaacacctctttgaaaatgagaaaggttgctgtggcggtctgcgac
atagttgccactcgtgcggcccgcttatctgctgctgggatgttgggagtgcttaagaag
ttaggtagagacacagttaaggacggagagaagcaaaaatcgatgattgcaatggatggt
ggcttgtatgagcactacaccgaattccgcaccagcatggaatgtactctcaaagagttg
ttgggtgacgaagttgctgagcacatttctgtcgagcactcaaacgatggctctggaatt
ggagctgccctcctggcagcctctcactcccagtaccttgaggtagaggagtcataa

DBGET integrated database retrieval system