KEGG   Malus domestica (apple): 103411439Help
Entry
103411439         CDS       T03194                                 

Definition
(RefSeq) thymidine kinase a-like
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mdm  Malus domestica (apple)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    103411439
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     103411439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
9
AA seq 255 aa AA seqDB search
MKAFAAFPSLFLPPQIFNTPSFCNTKSMASFKPSIPPTSDSSTSGEVHVIMGPMFAGKTT
ALLRRIKSEGNSGRNVAMIKSSKDTRYAIDSVVTHDGMKFPCWALPDLSSFRKNFGGDAY
DKLDVIGIDEAQFFEDLYDFCCMAADHDGKTVVVAGLDGDYLRRSFGSVLDVIPLADSVT
KLTARCEMCGKRAFFTLRKTEETRTELIGGADVYMPVCRQHYVNGQVLIKTARSVVESHK
FKSVSDTFSKATPVV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcgccgccttcccatctctcttcttacctccccaaatcttcaacaccccc
tctttctgcaacacaaaatccatggcctccttcaagccctccattccccccaccagtgac
tcttctacctccggcgaggtccatgtcatcatgggtcccatgttcgccggcaaaaccacc
gccctactccgccggatcaagtcggaggggaacagcggcaggaatgtggcgatgataaaa
tcgagtaaggatacaagatacgccattgattcggttgtgacgcacgatgggatgaagttt
ccgtgctgggcgctgcctgatctgtcatcgtttcggaagaattttggaggagatgcttat
gacaagcttgatgtcattggaatcgacgaggctcagttttttgaagatctatatgatttc
tgctgcatggctgctgatcatgatgggaaaactgtggttgttgcaggcttggatggcgat
tacttgaggaggagctttggctcggttcttgacgtaatacctcttgctgattctgtgacc
aagttgacggcgcgatgtgaaatgtgtggcaaacgagctttctttaccctgaggaagacg
gaggagactaggacggaactgattggtggtgctgatgtatacatgcctgtgtgtcgccaa
cattatgtcaacggacaagttctcattaaaacagcaagaagtgtagtggagtcccataaa
tttaagagtgtcagtgacacattttctaaagcaactccagttgtttag

DBGET integrated database retrieval system