KEGG   Malus domestica (apple): 103423359Help
Entry
103423359         CDS       T03194                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mdm  Malus domestica (apple)
Pathway
mdm03030  DNA replication
mdm03410  Base excision repair
mdm03420  Nucleotide excision repair
mdm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    103423359
   03410 Base excision repair
    103423359
   03420 Nucleotide excision repair
    103423359
   03430 Mismatch repair
    103423359
Enzymes [BR:mdm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103423359
    6.5.1.6  DNA ligase (ATP or NAD+)
     103423359
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103423359
DNA replication proteins [BR:mdm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103423359
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103423359
DNA repair and recombination proteins [BR:mdm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103423359
   NER (nucleotide excision repair)
    Other NER factors
     103423359
   MMR (mismatch exicision repair)
    Other MMR factors
     103423359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 103423359
NCBI-ProteinID: XP_008359654
LinkDB All DBs
Position
3
AA seq 796 aa AA seqDB search
MLSRSLCSCHCLLLPSLRRLHXPISLFRPKPSSLPLISLLPQNPNLRAMSSRPSAFDALM
SGARAAAAKKKPQPSPSKKRKALDSTXPIKKPQLLPTPESACATQDPESVEVKAPESKEI
KEAQESSGNGGEVVPAGKXVCVAAGAKERTEELKSRMPLLKKKAGEFDPKLVANWGQGER
VPFVFVCLVFDLIDKETGRIVITDIVCNMLRTVMYTTPEDLVPVIYLAANRIAPAHEGLE
LGIGDASIVKALAEACGRTEAHVKKQYKELGDLGHVAKESRSSQSMMRKPDALTVTKVFS
TFRLLAKESGKDSQEKKKNHIKALLVAATDCEPLYLIRLLQTKLRIGLAEQTLLTALGQA
AVYTEKHSTPPSHIQSPLEEAAKIVKQVYSLLPDYDKIIPALLSGGVWXLPEICNFTLGV
PVGPMLAKPTKGVSEIVQKFQDTEYTCEYKYDGERAQIHFMENGSVEIYSRNAERNTGKY
PDVVAAVSRLKKSSVTSFVLDCEIVAYDREKQKILPFQVLSTRARKNVSVSEIKVEVCIF
AFDMLYLNGQPLIQEQLKVRRECLYDSFVEEAGFFQFATALTSNDIDEIQKFLDAAVSSS
SEGLIIKTLTKDATYEPSKRSLNWLKLKKDYMDSIGDSLDLVPIAAFHGRGKRTGVYGAF
LLACYDSNNEEFQSICKVGTGLTEAMLEERSASLRTKVIPKPKSYYRYHDTMNPDVWFEP
SEVWEVKAADLTISPVHRAAVGIVDANKGISLRFPRLIRVREDKPPEQATSSEQVAELYN
AQAINHSNNQNDNEDD
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgctctcacgatcactctgttcatgccattgtctacttctcccctctctccgccgtctc
cacasccccatctccctcttccgccctaaaccctcttctcttcctctcatttccctctta
ccccaaaaccctaatcttcgcgccatgtcctcccgcccctccgccttcgacgccctcatg
tcyggygcccgcgccgccgccgccaagaaaaagccccagccttctccctccaagaagcgc
aaagccctagactccactkaccctatcaaaaaaccccaattgctgcctacgcccgaaagc
gcctgcgcaacccaagacccagaatccgtggaagtcaaagctccggaatccaaggaaatt
aaagaagctcaagaaagttctggcaatggcggtgaggtggttccggcagggaagamagtg
tgcgtggcggcgggtgctaaggagcggactgaggaattgaagagccgaatgccgctactg
aagaagaaagccggggaatttgacccaaaattggtggcgaattggggccagggcgagagg
gttccttttgtgtttgtttgtttagttttcgatttgattgacaaagagacgggtcgratt
gtgatcacggatattgtttgtaacatgttgaggactgtaatgtacaccacgcctgaggat
ttggtgcctgtgatttatcttgcggcgaataggattgctcctgcgcatgaaggtttggag
cttggaattggggatgcttcgattgttaaggcccttgcagaggcttgtgggaggactgaa
gcgcatgtgaagaagcaatacaaggagctgggagatcttggtcatgttgcaaaggaaagc
cgttcttctcaatctatgatgcgcaagcctgatgcattaactgtcaccaaggtttttagt
acatttcgtctactagctaaggaatctgggaaggatagtcaggagaagaaaaagaaccat
atcaaggcacttcttgttgctgccactgactgtgaacctctatatctgatccgtttgctt
cagacaaagttgcgaattggattggcagagcagactctattaactgcattgggacaagct
gcagtgtatactgaaaaacattcgacaccaccttctcatattcagagtcctctagaagag
gcagcaaagattgttaagcaagtgtactctctgcttcctgattacgataaaatcatccct
gcccttttaagtggaggtgtatggaakcttccagagatatgcaactttactttgggcgtc
ccagttgggcctatgctagcaaaaccaactaaaggggtatctgagattgtacagaagttt
caggatacagaatacacgtgtgaatacaagtacgatggagaacgtgcccagatacatttc
atggagaatggttctgttgagatatacagtcgaaatgctgaacgaaacactggaaagtat
cctgatgtggttgctgcagtgtcgaggttaaagaagtcatctgtaacatcattcgttttg
gattgtgaaattgttgcttatgaccgtgaaaaacaaaaaattctgcccttccaggtactc
agcactagagcgcgtaaaaatgtgagcgtgagtgagatcaaggttgaagtctgcatattt
gcttttgatatgttgtaccttaatggccaaccacttattcaggaacaactgaaagttcgt
agagagtgtctgtatgactcttttgtggaagaagctgggttttttcagtttgccacagcc
ttaacatcaaatgatattgatgaaatacaaaagtttcttgatgctgctgtcagttcragt
tctgagggtttaattattaaaacattgaccaaagatgctacttaygagccttcaaagcgg
tcacttaactggctgaaattgaagaaagattacatggacagtattggggactcactagac
ttggtacctattgctgctttccatggccggggaaaacgtacaggtgtctatggtgctttc
ctcctcgcttgttatgatagcaataatgaagagtttcaaagcatttgtaaagtaggcact
ggactcactgaagcaatgcttgaagaacgttctgccagtctccgtactaaagtgataccc
aaacctaagtcatactataggtatcatgatacaatgaatccagatgtatggtttgaaccc
tcagaggtttgggaggtgaaagctgcggacctgactattagccccgttcatcgtgctgca
gttggcatagtggatgctaataagggtatttctctccggtttccacgtcttattcgagtt
cgggaagacaaacctccggagcaagccacatcatctgagcaggtagccgagttgtataat
gctcaagcgatcaaccattcaaacaatcaaaatgacaacgaagatgattag

DBGET integrated database retrieval system