KEGG   Malus domestica (apple): 103427433Help
Entry
103427433         CDS       T03194                                 

Definition
(RefSeq) glutathione S-transferase-like
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mdm  Malus domestica (apple)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103427433
Enzymes [BR:mdm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103427433
Transporters [BR:mdm02000]
 Other Transporters
  Pores ion channels [TC:1]
   103427433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 213 aa AA seqDB search
MAAIKVHGNVISTAAMRVFATLYEKDIEFELVPIDMRAGEHKKEPFISLNPFGQVPAFED
GDLKLFESRAITQYIAHEYADKGTPLVIRDSKKMAIJSLWSEVEAQKFDPXATKLTYELA
IKPMFKMTTDAAVVEENEAKLAVVLDVYETRLAQSKYLAGESFTLADLHHLPTIHYLMGT
QSKKLFESRPHVLAWVXDITARPAWNKVVAQQK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatcaaggtccacggaaacgttatttcgaccgctgcaatgcgagtttttgct
actctctacgagaaagacatcgaattcgagcttgttccaatcgacatgagagctggtgaa
cacaaaaaggagcccttcatatccctcaatccatttggtcaagttccagcwttcgaagay
ggagatcttaagctctttgaatcaagggcgattacacaatacattgcccacgagtatgct
gacaagggaacccctctrgtgatccgagactcraagaagatggcaattmtatcattgtgg
tcggaggtggaggcccaaaagttcgacccgscggccacaaaactgacctatgagctagct
ataaagcctatgtttaaaatgaccacagacgcggcagttgtggaggaaaatgaagccaag
ttggctgtggttcttgatgtatatgagactcgtctggctcagtcgaaatacttggcaggt
gaaagcttcactttggctgatcttcaccacctccccaccatacattacttgatgggaaca
caatcgaagaagctgttcgaatcccgcccccatgttctcgcatgggtggyggayatcaca
gcaaggccagcttggaacaaagtcgttgcccagcaaaagtga

DBGET integrated database retrieval system