KEGG   Malus domestica (apple): 103444126Help
Entry
103444126         CDS       T03194                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mdm  Malus domestica (apple)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103444126
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103444126
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     103444126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
9
AA seq 183 aa AA seqDB search
MASSMISSATVSTVYXDRAAPAQASMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQC
MQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSPG
YYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP
AGY
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccatgatttcctccgctaccgtgtctacagtttacrccgaccgtgccgcc
ccggctcaagccagcatggttgctccattcactggcctcaagtcgtcctcagctttccct
gtcaccagaaagagcaacgacattacctctattgcaagcaatggaggaagagtgcaatgt
atgcaggtgtggcctccacttggattgaagaagttcgagaccctctcttaccttcctcct
ctctcttccgagtccttggccaaggaagttgattacctcctccgcaaaaactgggttccc
tgcttggaatttgagttggagcatggatttgtgtaccgtgagaaccacaaatccccagga
tactacgatggaaggtactggacaatgtggaagctgcccatgttcggatgcaccgactct
tctcaggtgttgaaggagctggaggaggccaagaaggcctatcccaacgccttcatccgt
atcatcggattcgacaacgtccgccaagtgcagtgcatcagtttcatcgcctacaagcct
gcaggctactaa

DBGET integrated database retrieval system