KEGG   Malus domestica (apple): 103444126Help
Entry
103444126         CDS       T03194                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00630  Glyoxylate and dicarboxylate metabolism
mdm00710  Carbon fixation in photosynthetic organisms
mdm01100  Metabolic pathways
mdm01200  Carbon metabolism
Module
mdm_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mdm_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mdm_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103444126
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103444126
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     103444126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 103444126
NCBI-ProteinID: XP_008381263
LinkDB All DBs
Position
9
AA seq 183 aa AA seqDB search
MASSMISSATVSTVYXDRAAPAQASMVAPFTGLKSSSAFPVTRKSNDITSIASNGGRVQC
MQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHKSPG
YYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP
AGY
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccatgatttcctccgctaccgtgtctacagtttacrccgaccgtgccgcc
ccggctcaagccagcatggttgctccattcactggcctcaagtcgtcctcagctttccct
gtcaccagaaagagcaacgacattacctctattgcaagcaatggaggaagagtgcaatgt
atgcaggtgtggcctccacttggattgaagaagttcgagaccctctcttaccttcctcct
ctctcttccgagtccttggccaaggaagttgattacctcctccgcaaaaactgggttccc
tgcttggaatttgagttggagcatggatttgtgtaccgtgagaaccacaaatccccagga
tactacgatggaaggtactggacaatgtggaagctgcccatgttcggatgcaccgactct
tctcaggtgttgaaggagctggaggaggccaagaaggcctatcccaacgccttcatccgt
atcatcggattcgacaacgtccgccaagtgcagtgcatcagtttcatcgcctacaagcct
gcaggctactaa

DBGET integrated database retrieval system