KEGG   Monodelphis domestica (opossum): 100009965Help
Entry
100009965         CDS       T01031                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00053  Ascorbate and aldarate metabolism
mdo00071  Fatty acid degradation
mdo00260  Glycine, serine and threonine metabolism
mdo00280  Valine, leucine and isoleucine degradation
mdo00310  Lysine degradation
mdo00330  Arginine and proline metabolism
mdo00340  Histidine metabolism
mdo00380  Tryptophan metabolism
mdo00410  beta-Alanine metabolism
mdo00561  Glycerolipid metabolism
mdo00620  Pyruvate metabolism
mdo01100  Metabolic pathways
Module
mdo_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mdo_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100009965 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    100009965 (ALDH7A1)
   00620 Pyruvate metabolism
    100009965 (ALDH7A1)
  Lipid metabolism
   00071 Fatty acid degradation
    100009965 (ALDH7A1)
   00561 Glycerolipid metabolism
    100009965 (ALDH7A1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100009965 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    100009965 (ALDH7A1)
   00310 Lysine degradation
    100009965 (ALDH7A1)
   00330 Arginine and proline metabolism
    100009965 (ALDH7A1)
   00340 Histidine metabolism
    100009965 (ALDH7A1)
   00380 Tryptophan metabolism
    100009965 (ALDH7A1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100009965 (ALDH7A1)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100009965 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     100009965 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     100009965 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 100009965
NCBI-ProteinID: XP_001362189
Ensembl: ENSMODG00000001001
UniProt: F7E9M6
LinkDB All DBs
Position
3
AA seq 540 aa AA seqDB search
MLPLTFSLSRQVLLGRRKILRVWNKPAAFMSTLLINQPQYSWLKDLGLKEENEGVYNGTW
GGRGEVVTSYCPANNEPIARVRQANLMDYEETLKKAKEAWKIWADIPAPKRGEIVRQIGE
ALRQKIQILGNLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALI
EQWNPLGLVGIITAFNFPVAVYGWNNAIALICGNVCLWKGAPTTSLISVAVTKIVAKVLE
DNNLPGAICSMTCGGADIGMAMAKDERVDLLSFTGSTQVGKEVAVVVQERFGRSLLELGG
NNAIIAFEDADLNLVIPSALFAAVGTAGQRCTTARRLFLHESIHDEVVDKLKKAYAQIRI
GNPWDSNVLCGPLHTKQAVNMFLGAVEDAKNQGGVVVYGGKIINCPGNYVEPTIVTGLPH
DASIVHRETFAPILYVLKFKNEEEVYSWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCG
IVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgctaaccttttctctttctcgacaagtccttcttggaaggaggaagatctta
agagtctggaacaaaccggctgcctttatgtctactttgctgataaatcagccccagtat
tcctggttgaaagatctgggactcaaagaagaaaatgaaggcgtgtataatgggacctgg
ggtggaagaggagaggttgttacaagctactgtccagctaacaatgaacccatagcaaga
gtacgtcaggccaacctgatggactatgaagaaacactaaagaaagccaaagaagcctgg
aaaatatgggcagatattccagcccctaaacgaggagaaatagtaagacagattggtgaa
gccttgcgacagaagatccaaatcttaggaaacttggtatctttggagatgggaaaaatc
ttagtagaaggtgttggagaagttcaggagtatgtcgatatctgtgattatgctgttggc
ttatcacgaatgattggaggacccatcttgccttcagaaagacctggtcatgccctcatc
gaacaatggaatcctttgggcttagttggaatcatcactgcatttaacttcccagtggct
gtgtatggctggaataatgccattgctctgatttgtgggaacgtttgcctttggaaagga
gcaccaacaacttcactcattagtgtagcggtcacaaagatagtggccaaagttttggaa
gataacaacttacctggtgcaatctgttctatgacatgtggtggtgctgatattggcatg
gcaatggccaaagatgagcgggtagacctgctgtccttcacaggaagcacccaagtgggg
aaagaggtggcagtcgtggtccaggagaggtttgggagaagtttgttagaacttggagga
aataatgctattattgcttttgaagatgcagacctcaatttagttataccttcagctctt
tttgcagccgttgggactgcaggccagagatgtacaactgctagacgactgtttttgcat
gaaagcatccatgatgaagttgtagacaaacttaaaaaggcatatgcacaaattcgcatt
ggaaatccatgggactcaaatgtcctctgtgggcccctccacaccaaacaagcagtaaat
atgttccttggtgcagtagaagatgccaaaaatcaaggcggtgtcgtggtctatggtggg
aagattataaattgccctggaaattatgttgagccaacgattgtgactggtcttcctcat
gatgcatccattgtgcacagagagacatttgctcctatcctttatgtcttaaaattcaag
aatgaagaagaggtctattcatggaataatgaagtgaaacagggtctttccagtagtatc
ttcacaaaggatttgggcagaatctttcgatggcttgggcctaaaggatcagactgtggc
atagtaaatgtcaatattccaacgagtggtgctgagattggaggtgcttttggaggtgag
aagcatactggtggtggcagagaatcaggaagtgattcatggaagcaatatatgagacga
tctacttgcaccatcaactatagtaaagaccttcctctggcacaaggaatcaagtttcag
taa

DBGET integrated database retrieval system