KEGG   Monodelphis domestica (opossum): 100010184Help
Entry
100010184         CDS       T01031                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7-like
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04014  Ras signaling pathway
mdo04062  Chemokine signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04371  Apelin signaling pathway
mdo04713  Circadian entrainment
mdo04723  Retrograde endocannabinoid signaling
mdo04724  Glutamatergic synapse
mdo04725  Cholinergic synapse
mdo04726  Serotonergic synapse
mdo04727  GABAergic synapse
mdo04728  Dopaminergic synapse
mdo04810  Regulation of actin cytoskeleton
mdo04926  Relaxin signaling pathway
mdo05032  Morphine addiction
mdo05034  Alcoholism
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
mdo05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100010184
   04010 MAPK signaling pathway
    100010184
   04371 Apelin signaling pathway
    100010184
   04151 PI3K-Akt signaling pathway
    100010184
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100010184
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100010184
  Endocrine system
   04926 Relaxin signaling pathway
    100010184
  Nervous system
   04724 Glutamatergic synapse
    100010184
   04727 GABAergic synapse
    100010184
   04725 Cholinergic synapse
    100010184
   04728 Dopaminergic synapse
    100010184
   04726 Serotonergic synapse
    100010184
   04723 Retrograde endocannabinoid signaling
    100010184
  Environmental adaptation
   04713 Circadian entrainment
    100010184
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100010184
  Substance dependence
   05032 Morphine addiction
    100010184
   05034 Alcoholism
    100010184
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100010184
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100010184
  Exosomal proteins of colorectal cancer cells
   100010184
GTP-binding proteins [BR:mdo04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100010184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CHASE8
Motif
Other DBs
NCBI-GeneID: 100010184
NCBI-ProteinID: XP_001362524
LinkDB All DBs
Position
3
AA seq 72 aa AA seqDB search
MSSKMSSGSDIGQARRAVEQLRMEAGIDRVQVSKAAGELLQYCVEHAKSDPFLMGIPAAV
NPFKEKKPCTIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaagatgtcaagtggcagtgacatagggcaggcccgccgggcagtggagcag
ctgcggatggaagctggcattgaccgtgtccaggtatccaaggcagcaggggagctcttg
cagtactgtgtggaacatgccaaaagtgacccattcctcatgggcatcccagctgctgtc
aaccccttcaaggagaagaagccttgcaccattctgtga

DBGET integrated database retrieval system