KEGG   Monodelphis domestica (gray short-tailed opossum): 100012916
Entry
100012916         CDS       T01031                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo01522  Endocrine resistance
mdo01524  Platinum drug resistance
mdo04010  MAPK signaling pathway
mdo04012  ErbB signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04024  cAMP signaling pathway
mdo04062  Chemokine signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04068  FoxO signaling pathway
mdo04071  Sphingolipid signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04114  Oocyte meiosis
mdo04140  Autophagy - animal
mdo04148  Efferocytosis
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04210  Apoptosis
mdo04218  Cellular senescence
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04270  Vascular smooth muscle contraction
mdo04350  TGF-beta signaling pathway
mdo04360  Axon guidance
mdo04370  VEGF signaling pathway
mdo04371  Apelin signaling pathway
mdo04380  Osteoclast differentiation
mdo04510  Focal adhesion
mdo04520  Adherens junction
mdo04540  Gap junction
mdo04550  Signaling pathways regulating pluripotency of stem cells
mdo04611  Platelet activation
mdo04613  Neutrophil extracellular trap formation
mdo04620  Toll-like receptor signaling pathway
mdo04621  NOD-like receptor signaling pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04650  Natural killer cell mediated cytotoxicity
mdo04657  IL-17 signaling pathway
mdo04658  Th1 and Th2 cell differentiation
mdo04659  Th17 cell differentiation
mdo04660  T cell receptor signaling pathway
mdo04662  B cell receptor signaling pathway
mdo04664  Fc epsilon RI signaling pathway
mdo04666  Fc gamma R-mediated phagocytosis
mdo04668  TNF signaling pathway
mdo04713  Circadian entrainment
mdo04720  Long-term potentiation
mdo04722  Neurotrophin signaling pathway
mdo04723  Retrograde endocannabinoid signaling
mdo04724  Glutamatergic synapse
mdo04725  Cholinergic synapse
mdo04726  Serotonergic synapse
mdo04730  Long-term depression
mdo04810  Regulation of actin cytoskeleton
mdo04910  Insulin signaling pathway
mdo04912  GnRH signaling pathway
mdo04914  Progesterone-mediated oocyte maturation
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04917  Prolactin signaling pathway
mdo04919  Thyroid hormone signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04926  Relaxin signaling pathway
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo04929  GnRH secretion
mdo04930  Type II diabetes mellitus
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo04934  Cushing syndrome
mdo04935  Growth hormone synthesis, secretion and action
mdo04960  Aldosterone-regulated sodium reabsorption
mdo05010  Alzheimer disease
mdo05020  Prion disease
mdo05022  Pathways of neurodegeneration - multiple diseases
mdo05034  Alcoholism
mdo05132  Salmonella infection
mdo05133  Pertussis
mdo05135  Yersinia infection
mdo05140  Leishmaniasis
mdo05142  Chagas disease
mdo05145  Toxoplasmosis
mdo05152  Tuberculosis
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05163  Human cytomegalovirus infection
mdo05164  Influenza A
mdo05165  Human papillomavirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05170  Human immunodeficiency virus 1 infection
mdo05171  Coronavirus disease - COVID-19
mdo05200  Pathways in cancer
mdo05203  Viral carcinogenesis
mdo05205  Proteoglycans in cancer
mdo05206  MicroRNAs in cancer
mdo05207  Chemical carcinogenesis - receptor activation
mdo05208  Chemical carcinogenesis - reactive oxygen species
mdo05210  Colorectal cancer
mdo05211  Renal cell carcinoma
mdo05212  Pancreatic cancer
mdo05213  Endometrial cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05216  Thyroid cancer
mdo05218  Melanoma
mdo05219  Bladder cancer
mdo05220  Chronic myeloid leukemia
mdo05221  Acute myeloid leukemia
mdo05223  Non-small cell lung cancer
mdo05224  Breast cancer
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
mdo05230  Central carbon metabolism in cancer
mdo05231  Choline metabolism in cancer
mdo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mdo05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100012916 (MAPK3)
   04012 ErbB signaling pathway
    100012916 (MAPK3)
   04014 Ras signaling pathway
    100012916 (MAPK3)
   04015 Rap1 signaling pathway
    100012916 (MAPK3)
   04350 TGF-beta signaling pathway
    100012916 (MAPK3)
   04370 VEGF signaling pathway
    100012916 (MAPK3)
   04371 Apelin signaling pathway
    100012916 (MAPK3)
   04668 TNF signaling pathway
    100012916 (MAPK3)
   04066 HIF-1 signaling pathway
    100012916 (MAPK3)
   04068 FoxO signaling pathway
    100012916 (MAPK3)
   04072 Phospholipase D signaling pathway
    100012916 (MAPK3)
   04071 Sphingolipid signaling pathway
    100012916 (MAPK3)
   04024 cAMP signaling pathway
    100012916 (MAPK3)
   04022 cGMP-PKG signaling pathway
    100012916 (MAPK3)
   04151 PI3K-Akt signaling pathway
    100012916 (MAPK3)
   04150 mTOR signaling pathway
    100012916 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100012916 (MAPK3)
   04148 Efferocytosis
    100012916 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100012916 (MAPK3)
   04210 Apoptosis
    100012916 (MAPK3)
   04218 Cellular senescence
    100012916 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100012916 (MAPK3)
   04520 Adherens junction
    100012916 (MAPK3)
   04540 Gap junction
    100012916 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100012916 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100012916 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100012916 (MAPK3)
   04613 Neutrophil extracellular trap formation
    100012916 (MAPK3)
   04620 Toll-like receptor signaling pathway
    100012916 (MAPK3)
   04621 NOD-like receptor signaling pathway
    100012916 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    100012916 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    100012916 (MAPK3)
   04660 T cell receptor signaling pathway
    100012916 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    100012916 (MAPK3)
   04659 Th17 cell differentiation
    100012916 (MAPK3)
   04657 IL-17 signaling pathway
    100012916 (MAPK3)
   04662 B cell receptor signaling pathway
    100012916 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    100012916 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    100012916 (MAPK3)
   04062 Chemokine signaling pathway
    100012916 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100012916 (MAPK3)
   04929 GnRH secretion
    100012916 (MAPK3)
   04912 GnRH signaling pathway
    100012916 (MAPK3)
   04915 Estrogen signaling pathway
    100012916 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    100012916 (MAPK3)
   04917 Prolactin signaling pathway
    100012916 (MAPK3)
   04921 Oxytocin signaling pathway
    100012916 (MAPK3)
   04926 Relaxin signaling pathway
    100012916 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    100012916 (MAPK3)
   04919 Thyroid hormone signaling pathway
    100012916 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    100012916 (MAPK3)
   04916 Melanogenesis
    100012916 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100012916 (MAPK3)
   04270 Vascular smooth muscle contraction
    100012916 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100012916 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100012916 (MAPK3)
   04725 Cholinergic synapse
    100012916 (MAPK3)
   04726 Serotonergic synapse
    100012916 (MAPK3)
   04720 Long-term potentiation
    100012916 (MAPK3)
   04730 Long-term depression
    100012916 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    100012916 (MAPK3)
   04722 Neurotrophin signaling pathway
    100012916 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    100012916 (MAPK3)
   04380 Osteoclast differentiation
    100012916 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100012916 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100012916 (MAPK3)
   05206 MicroRNAs in cancer
    100012916 (MAPK3)
   05205 Proteoglycans in cancer
    100012916 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    100012916 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    100012916 (MAPK3)
   05203 Viral carcinogenesis
    100012916 (MAPK3)
   05230 Central carbon metabolism in cancer
    100012916 (MAPK3)
   05231 Choline metabolism in cancer
    100012916 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100012916 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100012916 (MAPK3)
   05212 Pancreatic cancer
    100012916 (MAPK3)
   05225 Hepatocellular carcinoma
    100012916 (MAPK3)
   05226 Gastric cancer
    100012916 (MAPK3)
   05214 Glioma
    100012916 (MAPK3)
   05216 Thyroid cancer
    100012916 (MAPK3)
   05221 Acute myeloid leukemia
    100012916 (MAPK3)
   05220 Chronic myeloid leukemia
    100012916 (MAPK3)
   05218 Melanoma
    100012916 (MAPK3)
   05211 Renal cell carcinoma
    100012916 (MAPK3)
   05219 Bladder cancer
    100012916 (MAPK3)
   05215 Prostate cancer
    100012916 (MAPK3)
   05213 Endometrial cancer
    100012916 (MAPK3)
   05224 Breast cancer
    100012916 (MAPK3)
   05223 Non-small cell lung cancer
    100012916 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100012916 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    100012916 (MAPK3)
   05161 Hepatitis B
    100012916 (MAPK3)
   05160 Hepatitis C
    100012916 (MAPK3)
   05171 Coronavirus disease - COVID-19
    100012916 (MAPK3)
   05164 Influenza A
    100012916 (MAPK3)
   05163 Human cytomegalovirus infection
    100012916 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100012916 (MAPK3)
   05165 Human papillomavirus infection
    100012916 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100012916 (MAPK3)
   05135 Yersinia infection
    100012916 (MAPK3)
   05133 Pertussis
    100012916 (MAPK3)
   05152 Tuberculosis
    100012916 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100012916 (MAPK3)
   05140 Leishmaniasis
    100012916 (MAPK3)
   05142 Chagas disease
    100012916 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100012916 (MAPK3)
   05020 Prion disease
    100012916 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100012916 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    100012916 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100012916 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100012916 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100012916 (MAPK3)
   04934 Cushing syndrome
    100012916 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100012916 (MAPK3)
   01524 Platinum drug resistance
    100012916 (MAPK3)
   01522 Endocrine resistance
    100012916 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100012916 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdo03036]
    100012916 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100012916 (MAPK3)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100012916 (MAPK3)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100012916 (MAPK3)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100012916 (MAPK3)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100012916 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2
Other DBs
NCBI-GeneID: 100012916
NCBI-ProteinID: XP_001364363
Ensembl: ENSMODG00000015670
UniProt: F7EI48
LinkDB
Position
6:complement(158769021..158776980)
AA seq 380 aa
MAAVVAAEGGGGGEPRGVDGTGPGVPGKVEMVKGQPFDVGPRYTELQYIGEGAYGMVSSA
FDHVRKARVAIKKISPFEHQTYCQRTLREIQILLRCHHENVIGICDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPSKPKVPWVKLFPKA
DSKALDLLDRMLTFNPNKRITVEDALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPGAP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggtggtggctgctgaagggggagggggcggggagccccgaggagttgacggg
accggcccgggggtccccggcaaggtggagatggtgaagggtcagccatttgacgtggga
ccacgctacacagagctgcagtacattggggagggggcgtacggcatggtcagctctgcc
tttgaccatgttcggaaggcccgggtagccatcaaaaagatcagcccatttgagcaccag
acatattgccagcgtacccttcgggagattcagatcctgcttcgatgccaccatgaaaat
gtcattggcatctgtgacatccttcgggcacccacgctggaggccatgagggatgtttac
attgttcaggacctgatggaaacagacttgtataagctgctaaagagccagcagctgagt
aatgatcatgtctgctacttcctgtaccaaatcctacggggcctcaaatatattcactca
gccaatgtgctccatcgggacctcaaaccctccaacctgctcattaacaccacttgtgac
ctcaagatctgtgactttggtctggccagaattgctgaccctgagcatgatcacacaggc
ttcctgacagagtatgtggctacccgttggtatagagcaccagagatcatgcttaattcc
aagggctataccaaatccatcgatatctggtctgtgggctgtatcctcgcagaaatgctc
tccaatcggcccatctttcctgggaagcactatctggaccagctgaaccacattctaggt
atcctaggttctccatctcaggatgatctgaactgtatcatcaatatgaaagctcggaac
tacctacagtcccttccatccaagcctaaggtgccctgggtcaagctgtttcccaaggca
gactccaaagccctggacctgctggaccggatgttgacctttaaccccaacaagcgaatc
acagtggaggatgccctggcccatccctacttggagcagtactatgatccaactgatgag
ccagtggcagaagaaccctttacctttgacatggagctggatgaccttccaaaggaacga
ctgaaggaacttatcttccaagagacagcccgattccaacctggggccccaggagccccc
tga

DBGET integrated database retrieval system