KEGG   Monodelphis domestica (opossum): 100017915Help
Entry
100017915         CDS       T01031                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00250  Alanine, aspartate and glutamate metabolism
mdo00410  beta-Alanine metabolism
mdo00430  Taurine and hypotaurine metabolism
mdo00650  Butanoate metabolism
mdo01100  Metabolic pathways
mdo04727  GABAergic synapse
mdo04940  Type I diabetes mellitus
Module
mdo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100017915 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100017915 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100017915 (GAD1)
   00430 Taurine and hypotaurine metabolism
    100017915 (GAD1)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    100017915 (GAD1)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100017915 (GAD1)
Enzymes [BR:mdo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100017915 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 100017915
NCBI-ProteinID: XP_001367783
Ensembl: ENSMODG00000008529
UniProt: F7DHD9
LinkDB All DBs
Position
4
AA seq 594 aa AA seqDB search
MASSAPSSSSSSSNPGPDSNPTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRIVSAFKERQSSKNLISCENSEREARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLRKMREIVGWS
NKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTENVILIKCNERGKIIPADLEEKILEAKKKGYVPLYVNATAGTTVYGAFDPIAEIA
DICHKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILIRE
KGILQGCNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQV
NKCLDLAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSDDRREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATKSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttcggcaccttcctcctcctcctcctcttccaaccctggcccggactccaac
cccaccaacctgcgtcctacgacttatgacacctggtgtggggtggcccacggatgcacc
agaaaattgggactcaagatttgcggcttcttacaaaggaccaacagcctggaggagaag
agtcggattgtgagtgccttcaaggaaaggcaatcctcaaagaatctaatatcatgtgag
aacagtgagcgagaggcacggttccgccgaactgagactgacttctccaacctgtttgcc
agagacctgcttccagccaagaatggggaagagcaaactgtgcagttccttttggaggtg
gtggatatcctccttaactatgtgaggaagacttttgacagatcaaccaaggtgctggac
ttccaccacccacaccagttgctggagggaatggagggcttcaacctagagctatctgac
caccctgagtccttggagcagattctcgtggactgcagagatactctgaagtatggagtt
cgaacaggtcatcctcgatttttcaaccaactttctactggactggatattattggctta
gccggtgagtggctgacatcaactgccaataccaatatgtttacatatgaaattgcccca
gtgtttgtcctcatggagcaaataacccttaggaagatgcgagagattgttggatggtca
aataaagatggcgatggcatattttctccagggggtgccatatccaatatgtacagcatc
atggctgctcgatataaatacttcccagaagtcaaaaccaaaggcatggctgctgttccc
aaactggtcctctttacctcagaacatagtcactattcaataaagaaggcaggggctgca
cttggctttggaacagaaaatgtgattctgataaaatgcaatgaaagggggaaaatcatc
ccagctgatttggaggaaaaaattcttgaagccaagaaaaagggatatgttcctctttat
gtcaacgcaactgcaggcacaactgtatatggagcttttgatccgattgctgagattgca
gatatatgtcacaaatataacctttggttgcatgttgatgctgcctggggaggaggtctc
cttatgtcccggaagcaccgtcataagctcaatggcatagaaagagccaactcagttacc
tggaaccctcacaagatgatgggcgttctgttgcaatgctctgccattctcattcgggaa
aagggcatactccaaggatgcaatcagatgtgtgctggatacctattccaacaagataag
cagtatgacatttcctatgacactggagacaaggccatacaatgtggccgccatgtggac
attttcaagttttggttgatgtggaaagctaagggcacagtgggattcgaaaatcaggtc
aataagtgcctggatttggcagagtatctctatgccaaaattaaaaacagagaagaattt
gaaatggtttttgatggcgagcctgaacacacaaatgtttgcttctggtacattccacaa
agcctcaggggcatcccagacagtgatgacagacgagaaaaacttcacaaggtggcaccg
aagatcaaagctctgatgatggaatctggtacaactatggttggatatcagcctcaggga
gacaaagccaacttcttccgaatggttatctcaaatccagcagccaccaagtctgacatt
gacttccttattgaggaaatagaaagattggggcaagatctgtaa

DBGET integrated database retrieval system