KEGG   Monodelphis domestica (opossum): 100018670Help
Entry
100018670         CDS       T01031                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100018670 (SUV39H1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100018670 (SUV39H1)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100018670 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100018670 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET DUF2811
Motif
Other DBs
NCBI-GeneID: 100018670
NCBI-ProteinID: XP_001371797
Ensembl: ENSMODG00000010324
LinkDB All DBs
Position
X
AA seq 344 aa AA seqDB search
NTWEPRRNLRCANTLKQFHRDLEGEIIRRTGRRPRTVPPRHLDAALVEFLLQKGRQRKAL
QRWERELNARRSHKGSISVENEVDLNGPPKGFSYINEYKVAEGIAVTQVAIGCECKNCLE
APVNGCCPGVSLNKFAYNIQGQVRLQAGQPIYECNSRCRCSDDCPNRVVQRGISYNLCIF
RTSNGRGWGVRTLEKIRRHSFVMEYVGEIITSEEAERRGQVYDRQGITYLFDLDYVEDVY
TVDAAYYGNVSHFVNHSCNPNLQVYNVFIDNLDERLPRIAFFATRTIWAGEELTFDYNMQ
VDPVDMESTRMDSNFGLAGLTGSPKKRVRIECKCGTEFCRKYLF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
aacacctgggagccacgccggaacttgaggtgtgccaacaccttgaagcagttccaccga
gatctggagggtgagataatccgccgaacggggagaaggcctaggactgtgcctcctcga
cacctggatgcagccctggtagagttcttattgcagaagggccgtcagcggaaggctcta
cagcgttgggagcgagaactgaatgctaggcgctctcacaagggcagcatctcggtagaa
aatgaagtggacttaaatgggccccccaagggcttttcatacatcaatgagtataaggtg
gctgaagggattgccgtgacccaagtggccataggctgtgagtgtaagaactgtctggaa
gccccagtcaatggctgctgcccaggtgtatcactcaacaagtttgcttataacatccaa
ggtcaggtgcggctgcaagctggccagcccatctatgagtgtaactcccgttgccgctgc
agtgatgactgccctaaccgtgtggtgcagaggggcattagctacaacctgtgcatcttc
cgtacatcaaatgggcgcggctggggtgtccgcacactggagaagattcgccgccacagc
ttcgtcatggaatatgtgggtgagatcatcacttctgaggaggccgagcgtcgtgggcag
gtctatgatcggcaggggatcacctacctctttgatttggactacgtggaggatgtctac
acggtggatgcagcgtactacgggaatgtctctcactttgtcaaccatagctgtaacccc
aaccttcaggtttacaatgtcttcattgacaatctggatgaacgcctaccacgaattgcc
ttttttgccacccgaactatctgggcaggcgaggagctaacctttgactacaacatgcaa
gtggaccctgtagacatggaaagcacacgtatggactctaacttcggtctggctggtctc
acaggctctcccaagaagcgggtgcggattgagtgtaaatgtggaaccgaattctgccgg
aaatacctcttctag

DBGET integrated database retrieval system