KEGG   Monodelphis domestica (opossum): 100024848Help
Entry
100024848         CDS       T01031                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100024848 (SETD2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100024848 (SETD2)
Chromosome [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100024848 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 100024848
NCBI-ProteinID: XP_001375978
Ensembl: ENSMODG00000014043
LinkDB All DBs
Position
6
AA seq 2592 aa AA seqDB search
MKQQQSLPPPPKMGDFYDPEHPTPEEEENEGKIENVQKMGFIKGPMFKGVASSRFLPKGT
KTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNDKQNDTPNSPAIPLQADFVPKIKMD
PGDTSTITEESSPPKPKVELGKIHFKKHLLHVTSKPMLAAVTPVAASPPLPIIPSPIVTE
SVVTESPPQSPPPPPPALQVRTPSPPAPMSVITALPQIPTSVPVGTSLQSPPIDVAIRTS
KESLNTVVLESLELDTKQDTCSSELLDIVSQNVSENVDVSPQKEDSHIGKEEETPDSSKS
SLCYKKTSSKKKFSQSEGMFLGSESDEDSVQTSSSQRSHDFKNSASVEKERDSKKSLPTL
KVEDLGKSSRSKTERDDKHFSYSKMDRDSRYVSSRSRSERERRRSRSRSRSDRGPRTSSS
YSRSERSHYYESERRYHRSSPYRERPRYSRSYTDNRMRESSDSEEEYKKIYSRSSDSRRT
SSHSSFYRDSRTSAYSKSDRDSKLESFHMDAEKRGKYSSKPERESKRTSENELMKRCCSP
NEMGCRRGASYSKHESNTSRNKSAPWKSTQKPDKFKSSFCCTESTEEIKHQSHSLNLQTT
CSKSNELRMVVKIPERDKTMSPSSTNRLNDSPTFKKRGESPIFKSEFMGNDSHDSIKELD
TLSKGKYDPLRTYCPMELNVNGSPGEGSDLVTFCASKTEDIFTSSDDSINRSEVSPLIKT
NKSCVLPSNGFQSINRSKEKDLDDSSVQHSELNSSLKEMDPSVPSQQDKFESFPVITVDY
SKTIKESVDLRVSYCKTKDLDSCNTSNDNSPSLYQFETENIEPTVIKVIPNSFMNQDSDL
QSVICDNKNRKNLHSVQPTSEESEQNLRVKLASVNPCDSDSPVESSSLASVCSLTLGMKV
DNPSVIQHVEGKLPPGLDASPQNQSTEFLKHTVIEMIELNEQQITPETGKRVVPWKNRHN
SGLLMESLQTEDEEVQEEANASLPSGREKAASTEESFKKQEGSRNMLISGASEPLFSSCD
MSGLVEGDSIAHAPKCDSSGNASEFVSPIHADYSDSSQSTSDESDTEDTDSDDSSIPRNR
LQSVVIVPKKSTLPLEETSPCSSQSSQVNRHYSDHWEDDRPDSSKSYDERFEEMMSKNFS
QTEKFSLPKGVDKSPEVPYIESNRKQMDDFELETAQPQSDGVDSTSQADVVSDTIGLQNL
EGTASKESSVVTKPILRQQEELPPYSSEGLEGTLMKSRQQNNFPNRPDSRLGKADSDNFS
SSGDFSRVDGFHSAEDLGNLGWDFSQPEKPSTTYQQPDSSYGLYAGCNYQQSSEQYRSTH
NYWQGNGFWDPRLANRPPGIVYDRIQGHIPDSLTNDHEEEDDENWNDPRRPHFSNQSSKF
LAQLHKEKGSVQAHEISSNSSKDLSVVNEKKVSPKNLEKGDMKDRGPPKKRRQELESDSE
SDSDMQDRKKVRVEVEQLETLPSGSALVGPLCVMDDFRDPQRWKECARQGKMPCYFDLIE
ENVYLTERKKNKSHRDIKRMQCECTPVSKDDRAQGEIACGEDCLNRLLMIECSSRCPNGD
YCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYA
RNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVP
SGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDG
ELEALLENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTQSQSCLKSFLECHGLS
LLWIWMAELGDGRGNNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAIPHF
SEGDGYSSENTSRAHTPLNTPDPSTKPSTEADTDTPKKLVFRRLKIISENSMDSAISDAT
SELEGKDCKEDLDQLENAPVEEDEESQPQQLQPQQLTLQHLPPSKGDIETPVDSSKPPAS
EPETEHEAEAKESNGPKLEEPIAMETPSQDEEEGVSDVESERSQEQPDKTVDISDLATKL
LDSWKDLKEVYRIPKKSQTEKENNGDRGRDAIGLRDQAATPKTPNRSREREPERQTQSKE
KKKRRSSLSPPPSAYERGTKRPDDRYDTPTSKKKVRLKDRNKLSTEERRKLFEQEVAQRE
AQKQQQQMQNLGMTSPLPYESLGYSGPHHSFVGYPPGYPMQAYVDPSNPNAGKVLLPTPS
MDPMCSPATYEHSQNLGHSVEPSLTTPQPVPVVQHVATPMEVSTSQYVAQNEAVVHQESN
VAVLPASASGPVQGQSYSVWDSNQQTVTVQQPYSPAQSQTAIYYQGQTCQTVYGVTSPYS
QSTPPIVQNYPQAAGLQYIQGQQIFTAHPQSVVVQSTAAVTTIVAAGQPQPLQQPELVVT
NNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDEANLE
HEAEMDLGTPTYDENPMKSSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKP
DCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFG
TVYKPKEDTDLE
NT seq 7779 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcagcagtcgctgccgccgccaccgaagatgggggatttctatgacccagaa
caccccacccctgaagaagaagaaaatgagggaaagattgaaaatgtgcagaaaatgggt
ttcatcaaaggtccaatgttcaaaggtgttgcatctagtcgatttctgcctaaaggcacc
aagacaaaggtgaacttggaagagcaaggacgacagaaggtttcgttcagcttcagcctt
acaaagaaaactttgcaaaacaggtttctaactgcacttggaaatgataagcaaaatgac
actccaaactccccagctattccccttcaagcagattttgttcccaaaattaaaatggac
cctggagatacttcaactattacagaagaatcttccccaccaaaaccaaaggtggaattg
ggcaaaatccattttaagaaacatttgcttcatgtaacatctaagcctatgctagctgct
gtcactccagtagcagcatcaccacctcttcccataataccatcaccaatagtaacagaa
tcagtagtgacagagtcaccaccacagtcaccccctccaccacccccagccctacaagtt
agaacaccatcaccaccagcaccaatgtcagtaataacagccttgccacaaataccaaca
tcagtaccagtggggacatcattacaatccccaccaatagatgtagcaatcagaacctca
aaagagtctttaaatacagtagtactggaatctttagaattggacactaaacaagataca
tgttcttctgaactattagatatagtatctcagaatgtgtctgagaatgtagatgtatct
ccacaaaaagaagattcccatattgggaaggaagaagaaactccagatagttcaaagagt
tctctgtgttataagaaaacaagttctaagaagaaattttcacagtctgaaggcatgttt
ctaggttcagaatcggatgaagattctgttcagacttcctcaagccagcggtcacatgat
tttaagaattcagcaagtgtggaaaaggaaagagattcaaaaaagagcttacctacttta
aaagttgaagatttggggaaatcttcaagatctaaaactgagagagatgacaagcatttt
agttactcaaaaatggatcgagattctcgctatgtgtcttcccgttctagatcagaaaga
gagagaaggcggagcaggtcccgctccagatctgacagagggcctagaactagttcatcc
tattcccgatcagagcgctcacattattatgagtctgaacgaaggtaccataggagctcc
ccttatagagagagaccacggtattcccgttcttacacagataataggatgagagagagc
tctgattcagaagaggaatataagaaaatatattctagatccagtgactcaagacgtaca
tcttctcattcttcattttacagagactcaaggacatcagcttactctaaatctgatcgg
gatagcaaacttgaatctttccacatggacgcagaaaaaaggggaaagtattcctcaaaa
ccagaaagagaatctaaaaggacttcagaaaatgaattaatgaaaagatgttgctcccct
aatgagatgggatgtcggagaggtgcatcttattctaaacatgagagtaatacttcccgt
aataagtctgccccatggaagagtacacaaaagcctgataaatttaaaagttctttctgt
tgtacagaatcaactgaggaaattaaacatcaatctcattctttaaatttacagactact
tgttcaaaatctaatgaattaagaatggttgtaaaaattcctgaaagagataaaactatg
tctccatcttcaacaaatcgattaaatgattcacctacttttaaaaagcgaggtgaatct
cctatttttaagtctgaatttatgggaaatgatagccatgatagtattaaggaattagac
actttatctaaagggaaatatgatccattaagaacttattgtcccatggaattaaatgta
aatggatcccctggggagggatctgatttagtaactttctgtgcctctaaaactgaggat
atttttacgtcttcggatgatagtataaatagatcagaggtatctcctttgataaaaact
aataaatcatgtgtattaccatcaaatggatttcaaagtataaacaggtctaaagaaaaa
gatttggatgattcttctgtacagcacagtgagttaaatagctcacttaaagaaatggac
ccttcagttccttcacaacaagataaatttgagtcttttccagttataactgtagattac
tctaaaacaattaaagaatctgttgatttgagagtttcttactgtaaaaccaaagatttg
gactcctgtaatacttcaaatgacaatagtccttctttgtatcaatttgaaactgaaaat
attgagcctacagttataaaggttatcccaaacagttttatgaaccaagactcagactta
cagtcagtaatatgtgacaataaaaaccgtaagaatcttcattcagtacagcctacatct
gaagaatctgagcagaaccttagggtaaagttggcatctgttaacccttgtgactcagat
tcacctgtagaaagttcaagtcttgcttctgtgtgtagccttacactaggaatgaaagta
gacaatccatctgttatacaacatgttgaagggaaattgcctcctggtttggatgcttcc
ccacaaaaccaaagcacagaatttctcaaacatacagtaatagaaatgatagaattgaat
gaacagcaaataactcctgaaacaggaaaaagagttgtaccttggaagaatagacataat
agtggactgcttatggaatctttgcaaacagaggatgaggaggtacaagaggaagcaaat
gcttcactccccagtggaagagagaaagctgcatccacagaagagtcatttaagaagcag
gaaggaagtagaaacatgcttatttctggtgcttcagagcctttgttttcatcttgtgat
atgagtggacttgtagaaggagatagtattgctcatgcccctaaatgtgacagtagtggc
aatgcatcagaatttgtatctcccatccatgcagattattctgattcttcacagagcaca
agtgatgaaagtgatacagaggatacagattctgatgacagcagtataccaaggaaccgt
cttcaatctgttgttattgtgccaaagaagtctactttgcctctggaagaaaccagtcct
tgctcatctcagagcagccaagttaataggcactattctgaccattgggaagatgacaga
ccagactcaagcaaatcttatgatgaaagatttgaggaaatgatgagcaaaaatttttct
cagaccgagaaattctctcttcctaaaggagtagataaaagccccgaagttccttatata
gagtcgaacagaaaacagatggacgactttgaattagaaactgctcagcctcagagtgat
ggcgttgatagtacaagtcaggcagatgtcgtatctgatactattggtctgcaaaatcta
gaaggaactgcatctaaagagtcatcagttgtaactaaacccatcctgaggcagcaagag
gaactcccaccttattcttctgagggccttgaaggtaccctaatgaaatctcgacaacag
aacaatttccctaataggccagatagtagactgggaaaagcagattcagataatttttct
tcttcaggagacttctctagagtagatggtttccattcagcagaagacctcgggaatctt
ggttgggacttctcccaaccagaaaaacccagtaccacttatcagcagcctgatagcagc
tatggattatatgctgggtgcaattatcagcaaagttcagaacagtaccgtagcacacat
aattactggcagggcaatggcttttgggatccgagattggccaataggcctcctgggatt
gtgtatgatagaatacagggacatataccagattccttaacaaatgaccatgaagaagag
gatgatgaaaattggaatgatcctcgcagacctcatttttctaaccagtctagtaaattt
cttgcacaacttcataaagagaaaggatctgtgcaggcgcatgaaataagtagcaactct
agtaaggacctttcagttgtaaatgaaaaaaaagtctctccaaagaacctggaaaaaggt
gatatgaaagatcgagggcctccaaagaaaagaaggcaagagttagaaagtgactcagaa
agtgattctgatatgcaagacagaaaaaaagtgagagtggaggtagagcagttggaaaca
ttgccttcaggttcagcattagttggtccactgtgtgttatggatgacttcagggaccca
caacgatggaaggaatgtgccaggcaggggaaaatgccttgttattttgaccttattgaa
gaaaatgtatacttaacagaaagaaagaagaataaatcccatcgggatatcaagcgaatg
caatgtgagtgtacacctgtttctaaagatgatagagctcaaggagaaatagcatgtgga
gaagattgtcttaatcgtctcctcatgatagaatgttcttcacgttgtccaaatggagac
tattgttccaatagacgattccagagaaaacagcatgcagatgtggaagtaatattaact
gaaaagaaaggctggggtctgagagctgccaaagacctcccatcgaacacctttgtcttg
gaatactgtggagaggtattagaccataaagaatttaaagcaagggtgaaggaatatgcc
cgtaacaagaatatccactattatttcatggcactgaagaatgatgagataatagatgcc
actcagaaaggaaattgctctcgtttcatgaaccacagctgtgagccaaactgtgaaaca
cagaagtggactgtgaatggacagctgagagttggctttttcactactaagttggttcct
tcaggttcagagttaacatttgactatcaatttcaacgatatgggaaagaagctcagaaa
tgtttttgtggctcagcaaactgcaggggttaccttggaggagaaaatagagtcagcatt
cgtgcagctggaggaaaaatgaagaaggagcgatctcgtaagaaagactctgtggatgga
gaacttgaagcacttctagaaaatggtgaaggcctttcagataaaaaccaggtgctcagt
ttatcaaggttgatggttagaattgagactttggagcagaaactaacctgtctcaaactt
atacagaatacccagtctcagtcctgcttaaagtccttcctagaatgccacgggctgtct
cttttgtggatttggatggcagagctaggtgatggtcgaggaaacaatcagaaactacag
gaagagattataaagaccttggaacatttgcctattcctacaaaaaatatgttggaggag
agcaaagttcttccaatcatccagcgctggtctcaaaccaagactgctatcccccacttc
agtgaaggtgatggttattccagtgaaaatacttcacgtgcacacacaccactcaacaca
cctgatccttccaccaagcccagcacagaggctgacacagatactccaaagaaacttgtg
tttcgtagacttaaaattataagtgaaaatagtatggacagtgcaatttctgatgctacc
agtgagctagaaggcaaggattgcaaagaagaccttgatcagttagaaaatgctcctgtg
gaagaagatgaagaatcacagccacaacagctgcaaccacagcagcttaccctacaacac
ttgccaccaagcaaaggtgacattgaaaccccagtggacagcagtaaaccgcctgcctca
gagccagaaactgagcatgaagctgaggccaaagagagtaatggcccaaagctagaagaa
cctattgctatggaaacgccttcccaagatgaagaggagggtgtgtctgatgtggagagt
gagaggagtcaagagcagccagacaaaacagtggatataagtgatctagccactaaactc
ctagatagttggaaagacttaaaggaagtgtatcgaattcccaaaaagagtcagactgaa
aaagagaacaatggtgataggggaagggatgctataggtctcagagaccaagcagctacc
ccaaagactcctaaccgatccagagaaagagaaccagaaaggcaaacacaaagcaaagaa
aaaaagaaacgaaggagttccctttcacccccaccttctgcttatgaacgaggaacaaaa
agacctgatgatagatatgatacacccacttctaagaaaaaagttcgtcttaaggaccgc
aataagctttccacagaagagcgcaggaagctatttgaacaggaggtggcccagcgagag
gcccagaagcagcagcaacaaatgcagaaccttgggatgacttcccccctgccctatgag
tctttgggctatagtggtcctcatcatagctttgtcggctaccctcctggttatcccatg
caggcctatgtggatcctagcaatcctaatgctgggaaggtgctattacccacgcctagc
atggaccctatgtgttctcctgccacctatgaacattcccagaatttgggacattcagta
gaaccaagtctcactactcctcagccagttccagtagtgcaacatgtagcaacaccaatg
gaggtttcaacttcacagtacgtagcacagaatgaagctgttgttcatcaggaatctaat
gtagctgttttgccagcatctgcctcaggtcctgtacagggacaaagttatagtgtttgg
gattctaatcaacagactgtcactgtgcagcagccatactcgcctgcacagtctcaaaca
gctatatattaccaggggcagacatgtcagactgtttatggtgtgacatcaccttattct
caatcaactccaccaattgtacagaattacccacaagcagcagggcttcagtatattcaa
gggcaacaaatttttacagctcacccacagagtgtagtagtacagtcaacagcagcagtg
actactatagtagcagcagggcagcctcagcccttacaacaaccggagttagttgtaaca
aataacctcctggatttgccaccaccatcaccacccaaaccaaaaaccattgtcttgcct
cctaactggaaaacggcccgggatccagaaggaaagatctactattaccatgtcatcaca
aggcaaactcagtgggatcctcctacttgggaaagcccaggagatgaggccaaccttgaa
catgaggctgaaatggacctgggaacaccaacttatgatgaaaatcctatgaagtcttcc
aaaaaacccaaaactgcagaagcagatacctcaagtgaattggccaagaagagcaaagaa
gtgttcaggaaagagatgtcccagtttattgtgcagtgcctgaacccttatcgaaaacct
gactgcaaagtggggagaataaccacaaccgaagacttcaaacatttagcccgcaagctg
actcacggtgtcatgaacaaggagctgaaatactgtaagaaccctgaagacttggagtgc
aatgagaatgtgaaacacaaaacaaaggagtacatcaaaaagtacatgcagaagtttggg
actgtttataaacccaaagaagacacagacttggaataa

DBGET integrated database retrieval system