KEGG   Monodelphis domestica (opossum): 100025797Help
Entry
100025797         CDS       T01031                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    100025797 (ACE)
   04614 Renin-angiotensin system
    100025797 (ACE)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100025797 (ACE)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100025797 (ACE)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100025797 (ACE)
Peptidases [BR:mdo01002]
 Metallo Peptidases
  Family M2
   100025797 (ACE)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100025797 (ACE)
CD molecules [BR:mdo04090]
 Proteins
  100025797 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2
AA seq 1655 aa AA seqDB search
MFFSARSCPGPLVRQLFLLLLLLICLLLPPAQALSAELMPGNFTADEAGARLFADSYNSS
AEVILYESTVASWTYNVNITQENAQRQSMISQWKRRQSLGTSNDAKKCAHRYFVSFVLQF
QFHKALCAEANYSGPLHYCDIYQSQEAGVKLREVLQAGASRPWQEVLKGLTGSEILDAEP
LLEYFKPLITWLQEQNQINGEVLGWPDFEWRPPVPDGYPEGIDKLADEAEAEKFLEEYVR
LRQVITNAYVETSWAYNTNITDENSKIMLEKNLEVSQHTLQFGTRARQFDTSNFQKSSVK
RLLEKLQDLGRAALSTTDLNEYNNVLLKMESVYSKAKVCQENGSCLPLDPDLTNLMAVSR
DYDNLLWAWKGWRDVTGQAILPSFPEYVDLSNKAAQLNGYADAGASWRSQYETSSLEEQL
EKIYLELQPLYLNLHAYVRRALYRHYGANYINLQGPIPAHLLGNMWAQSWSNIYELVVPF
PSASQVDATPAMKSQNWTAQRMFEEADKFFQSLGLLPLPPEFWDKSMLEKPKDGRDVVCH
ASAWDFYNGKDFRIKQCTVVNMEDLIVIHHEMGHVQYFMQYKDQPLTFREGANPGFHEAI
GDVLALSVSTPKHLHSIGLLDNEGEGYESEINYLMSIALDKIAFLPFGYLIDQWRWRVFD
GSINKKDYNQEWWNLRLKYQGLCPPVPRSQEDFDPGAKFHIPANVPYLRYFVSFVIQFQF
HEALCRAAGHTGPLYKCDIYQSKEAGKLLADAMKLGLSQPWPEAMKLITGQPNMSATAIM
NYFQPLLDWLITKNKEQGETLGWPQYDWTPYSGASSAPNVPNSGKVSFLGMELERGQATA
GQWVLLVLGLVLLVATMGLAYKTCSLKRREEPYFGSEVELRHSCHIVGFWLVGRYTVSQF
VCPLAMDRYWIFSLGSSIFLLCSCGQFLSLLRVGKAETSEEDDHSLPNSPKRTSESEEEA
NTFLKEYEKTALIVWHDYVEAAWNYNTNITLYNRQQMLEKNFLMAQHTLYYGTKALQFNI
TNFTDPLLKRILWKLREMERAILPQDDLMEYNQLLTNMETIYNMGDVCSEEGPCMFLEPD
LLKVMAFSRNYNELLWAWQGWRDTMGQQLRPIYTRFVELSNKAARLNGHTDTGASWRQIY
ESPTLEQDLEQLYQQLEPLYLNLHAYVRRALYNYYGSQYINLKGSIPAHLLGNMWGQSWI
NIIDLVIPFPLSTRINVTMLMKSQHWTPYKMFEEADKFFQSLGLFPVLPEFWAKSMLEKP
GDGRAMSCQASAWDFYDGKDFRIKQCTGVNMEDLISVFHEMGHIQYFMQYKNLPLPLRDG
ANPGFHEAIGDVAALSVSSLKYLHNSDLLINEIEDYESEINFLMSIALKKIAFIPFSYLV
DQFRWRVFDGRITKQFYNKKWWDLRLKYQGLCPPVPRSEEDFDPGSKFHIAGNVPYIRYF
ISFVIQFQFHEALCQAAGHKGPLHTCNIYSSQEAGKLLGDVMKLGFSKPWPEAMKMITGQ
YNMSAKPLMEYFKPLLDWLIAENVRNEEVLGWPEFGCFIYDDAEKKVRILPLSLNSTNTV
AGQWLLLAMCLLLMLLIASLLYEAVAEQYRTSDPDKEGTFPGIPGKIPHAVRSQYLLFIL
SLFLLLSVVLLSVCVFFLNSKKHWNFSSNREQSEK
NT seq 4968 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctcagcccggagctgccctgggccgctcgtgcggcagcttttcctcctgctg
ctgctgctgatctgtcttcttctgccgcctgcccaggccctatccgccgagctgatgccc
gggaattttaccgccgacgaggccggggcgaggcttttcgccgacagctacaactcctca
gcggaggtcatcctgtatgagagcaccgtggccagctggacttacaacgtcaacatcacc
caagagaacgcgcagcggcagtcgatgataagccaatggaagcggaggcagagcttgggt
acttccaatgatgccaagaaatgtgcccacaggtattttgtgagttttgtccttcagttc
caattccacaaagccctgtgtgctgaggcgaactacagtgggcctctacactactgtgac
atctaccaatctcaagaggctggtgtcaaactcagggaggtgttgcaggcaggtgcttct
cggccatggcaggaggtgcttaagggattgacaggctcagagatcctggatgcagaacca
cttcttgaatacttcaagcccctcatcacctggctgcaagaacagaaccagatcaatggc
gaggtcctgggctggcctgattttgagtggcgtccaccagtgccagatggctatccagag
ggcatcgacaagctggctgatgaagcagaggctgagaagttccttgaggagtatgtccgg
ttgaggcaagtcataacgaatgcttacgtagagaccagctgggcttacaacacaaacatc
accgatgaaaatagcaagattatgttggaaaagaacctggaggtgtctcaacacacgcta
caatttggcacccgtgcccgccagtttgataccagcaatttccagaagtcctctgtgaag
cggctcttggaaaagcttcaagatctgggtcgagcagccctctccactacagatttgaat
gagtacaataacgtactgttgaagatggaatcggtatacagtaaagccaaagtgtgccag
gaaaatggttcctgtttacccctggatcctgatttgacaaatttgatggctgtatctcgg
gactatgacaacttgctatgggcttggaaaggttggagggatgtgacaggacaagctatc
cttcccagcttcccagagtatgtggaccttagcaacaaggctgctcagctcaatggctat
gccgatgctggagcctcctggagatctcagtatgaaacatcttccttggaggagcaactg
gagaaaatctatctggaactgcagccactctacctgaacctacatgcctatgtccgtcgt
gcactgtaccgtcattatggagccaactacatcaatcttcaagggcccattcctgctcat
cttttaggcaacatgtgggctcaaagctggtccaacatttatgagttggtggtgcccttc
ccctctgccagccaggtagatgccactccagctatgaaaagccagaactggactgcccag
aggatgtttgaagaggcagacaaattcttccagtccctgggtctgttgcccttaccccct
gagttttgggacaagtcaatgctggagaagccaaaagatgggcgagatgtagtatgtcat
gcttctgcctgggatttctacaatggcaaggacttcaggatcaaacagtgcacagttgta
aacatggaggacctcattgtcatccaccacgagatgggccatgtgcaatatttcatgcag
tacaaagaccaacctctgaccttccgagagggtgctaacccaggttttcatgaggctatt
ggagatgtgctggctctctctgtctctacccccaagcacttacatagtattgggctgctt
gataatgagggagagggctacgagagtgagatcaactacctgatgagtattgcactggac
aagattgccttcctcccttttggttacctcattgaccagtggcgctggcgggtgtttgat
gggagtatcaataagaaagattataaccaggaatggtggaatctcaggctaaagtaccag
ggtctgtgtccaccagtgccaagatcacaagaagattttgacccaggtgccaagttccac
atacctgcaaatgtaccctatctcagatactttgtcagctttgtgattcagttccagttc
cacgaggccctgtgccgagccgctggccacacaggcccactttacaagtgtgacatctat
cagtcaaaggaggcagggaagctcttggcagatgcgatgaagctgggactcagtcaaccc
tggccagaagccatgaagctaattacagggcagcccaacatgtcagctacagctattatg
aactatttccagcccctcctggattggcttatcaccaagaacaaggagcagggagagaca
ctaggctggcctcagtatgactggactccatattctggtgcctccagtgctcccaatgta
ccgaacagtggcaaagtcagcttcttgggaatggagctggagcgtgggcaggctacagca
gggcagtgggtactgcttgtcctgggcctggtgttgcttgtggctacaatgggcttggcc
tataagacatgtagcctcaaacgtagagaggagccttattttggctctgaggtggagctg
agacactcctgtcacattgttgggttctggttggttgggagatacacagtctcccagttt
gtatgtcctttagctatggacagatattggattttttcccttgggtcttccatatttcta
ctttgctcttgtgggcagttcctctcactgctcagagtggggaaagctgagacttcagaa
gaggatgaccatagtctccccaactctcccaaaagaacatcagaaagtgaggaagaggca
aatacattcctgaaagagtatgaaaagacagctctaattgtgtggcatgattatgtggaa
gctgcctggaattacaacaccaacatcactctgtataatcgtcagcaaatgctggaaaag
aacttcctgatggctcagcatacattatattatggcacaaaggctctccaatttaatatc
accaacttcactgacccactactgaagcgcatcctgtggaagctgagggaaatggagagg
gccatccttccccaggatgaccttatggagtacaatcaacttctaacaaatatggagaca
atctacaacatgggtgatgtgtgctcagaagagggaccttgcatgttcctggagcctgac
cttctaaaggtgatggccttctccaggaactataatgaacttctctgggcatggcaaggt
tggagggacactatgggccaacagctgcgccccatctacactcggtttgtggagctcagc
aacaaggctgccaggctcaatggtcacacagatacaggggcctcctggagacagatatat
gagtcacccaccttggaacaagaccttgagcagctctatcagcaactagaaccactctac
ctaaacctgcatgcttatgtgcgccgagctctttacaattactatggatctcaatacatt
aacctaaagggatccattcctgcccacctactggggaatatgtggggtcagtcctggatc
aacataattgacctagtcataccctttcctttatccaccagaataaacgtcaccatgctc
atgaaaagccagcactggacaccctataagatgtttgaggaggctgacaaattcttccag
tctctggggctgttccctgttctccctgaattctgggccaaatcaatgttggagaagcca
ggggatggaagagcaatgtcgtgccaagcttctgcctgggacttctatgatggaaaggac
ttcaggataaagcagtgcactggggtgaatatggaagatctgatatccgtcttccatgag
atgggccatatccaatacttcatgcagtacaagaatctgcccttgccactccgagatggg
gccaacccaggcttccatgaggccataggggatgtggcagccctctctgtctcctccctc
aagtaccttcacaactcagacctgctgatcaatgaaatagaggactatgaaagtgaaatc
aacttcctcatgagtatagcattgaaaaagattgccttcatccccttcagctacctggtg
gaccagtttcgttggagagtctttgatggccgcatcaccaagcaattttacaataagaaa
tggtgggacctaaggttaaaatatcagggattgtgcccaccagtgccaaggtcagaggaa
gactttgacccaggttctaagttccatattgctggcaatgtgccttatatcagatatttt
atcagctttgtgatccagttccaattccatgaggccctgtgccaagccgcaggccacaaa
ggccccctacacacatgtaatatatacagctcccaagaagcaggaaaactcctgggggat
gtcatgaaacttggattcagtaagccatggccagaagcaatgaagatgattactggacaa
tataacatgtcagcaaaacctctcatggagtactttaagcccctgcttgactggctcatt
gcagagaatgttcgtaatgaagaagtcctgggttggcctgaatttggctgcttcatctat
gatgatgcagaaaaaaaagtgagaatcctgcctctgagtttgaactccaccaacacagtt
gctgggcagtggctgctgctggccatgtgcctactactaatgctgctcatagcaagtcta
ctctatgaggctgtagcggagcaatacaggacatctgaccccgataaggaaggcacattt
cctgggatccctgggaaaatcccgcatgctgtcaggagccagtacctgcttttcatcttg
agtctgtttctgctgctctctgtggtgttgctctctgtctgtgtcttcttcctcaactcc
aagaaacactggaatttcagttccaatagggaacaaagtgaaaagtag

DBGET integrated database retrieval system