KEGG   Monodelphis domestica (opossum): 100028710Help
Entry
100028710         CDS       T01031                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100028710 (SETDB2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100028710 (SETDB2)
Chromosome [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100028710 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100028710 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
4
AA seq 1018 aa AA seqDB search
MAHKLVCILTHCHSLQPSISFSLSCDAKAFWRELEEDGKLDLIFEHVQNVLLSLKQKIKD
GSATNQEYIQAMTLVNEAVTSNTLLLIKDDDITDRDSEQESKSSILPPTSQEDSNSEDSL
ILTVEDIAVLTLENEVSNYEEKILALSLPYQSHDCCDTCLPKIPLTSKVENPLMIPILCR
FQRRHAKTNSNYATFHVNYKTPCGRSLRNFKEVHRYLLETESSFLFLHNFSFNTYVQLNR
NTPKKEVFVSDSDISHGTESVPITFCNEIDNRRLPHFKYRRRTWPRAYYLNNFSGMFSNS
CDCSKGCMDITKCACLQLTAKGYDESSAYDQNVKPTHGYSYKRLQQPVPNGIFECSLLCK
CDPRTCQNRVVQQGLQVRLQVFKTEKKGWGVRCIDDIDKGTFVCTYSGRLLSRVGLEEIG
SVDGKEEEEEEDAATNDNGPPALSKKRRTEAAYSDPEIEFVQVEVGAIPGDSETQEYLIQ
LSSDANPSIQGEKYEYDLRTENQPATRRPKTKTALLQNYRKKRGIVTLESGISSDEEDEV
QSPEVQTTPNIREEKMESSCSGENSKEKLLTTSTGLDNHHCKAERLVENIGDPLASMFDM
SGIKECKDRDQVSHEERTRERQNQEIFCDEESLSEVQIGVSESIKKFCEDGIYLLDATKE
GNVGRFLNHSCNPNLFVQNVFVETHDRNFPWVAFFTKRHVKAGTELTWDYGYEAGSIPEK
EIPCQCGFHTCRKRITPGRGAGHLPFSRMSSPTPTELSLEEPGLALSIMATDEALRDPAG
IFQERMVKITCDLCPQDDERGILYVSQDLECVAHQNCLLYSSGLVESEGNHPCLNEEDRN
FDVKLVNEEISRGKRLKCSFCLRKGATVGCDIKKCPKNYHFFCARQDHAILKADDSIGIY
RVFCQKHATGSSNLDLLKKMKKAGLIENLFEALLEDLDGIHSKINDTTTSEKELQEIATS
LFDCAIFKKTLKKLSTETVIKKLQREQVQLQRKIEVLQGIRERMPLPQEDSIKHSAGP
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atggcccataaactagtatgtattctaacccattgtcattctttgcagccatccatctct
tttagtttgtcatgtgatgcaaaagctttttggagggaactggaagaggatggaaaattg
gacttgatatttgaacatgtacagaatgtactgttgtcattgaaacaaaagatcaaagat
gggtcagccacaaatcaagagtacatccaagccatgaccctggtgaatgaagcagttaca
agtaacactttactcttgataaaagatgatgatataactgacagggacagtgaacaagaa
agcaaatcaagtattttacctccaacatcacaggaagactccaattcagaagactcattg
attttaaccgtggaggacatagcagttctaactttggaaaatgaagtttcaaattatgaa
gagaaaatactagctttgagtctgccctatcagagtcatgactgctgtgatacatgtctg
ccgaaaatacctctcacctccaaagtagaaaacccactcatgatccccatcttatgtcgt
ttccaaaggcgacatgcaaagacaaattctaattatgccacattccatgtgaattataaa
accccttgtggaaggagtttgagaaactttaaggaagttcaccgttacctgcttgagaca
gaaagtagctttttatttttgcataatttttctttcaatacctatgtgcagttgaatagg
aatacaccgaagaaagaagtctttgtttctgactctgatatcagccatggaactgaatct
gtgcctattaccttctgtaatgaaattgacaacaggaggctgccacacttcaagtaccgg
aggcggacgtggccacgtgcctactacctcaacaatttctctggcatgtttagtaattca
tgtgactgctcaaaaggatgcatggatataacaaaatgtgcatgcctccagctgacagca
aagggctatgatgagagttctgcatatgatcagaatgttaaacccactcatggctatagc
tataaaagactgcagcagccagtacccaacggaatttttgaatgcagcctcttatgcaaa
tgtgatccaagaacatgtcagaatagagttgtccagcagggtctccaagtgcgccttcag
gtgttcaaaactgagaagaagggatggggagtccgctgcatagatgacattgacaaaggg
acatttgtttgcacttactcagggagattactaagcagagttggcctagaagaaattggc
tctgttgatggaaaagaggaagaggaggaggaggatgctgctaccaatgacaatgggccc
ccagcactttcaaagaagaggagaacagaagctgcttattctgatcctgaaattgagttt
gtccaggttgaagtgggagcgattcctggagactcggagactcaggagtacctgattcag
ctcagcagtgatgcaaatccatctattcagggtgagaagtatgaatatgatctaagaact
gaaaaccaaccagccactagaagacctaaaactaaaacagcccttcttcaaaattatcgg
aaaaaaaggggaattgttaccctggagtctggtataagctcagacgaggaggatgaagtt
caatcacctgaagtccaaacaactcccaatatcagggaagagaaaatggagtctagctgc
tctggtgaaaattccaaagaaaagctgttgaccacatctaccgggctggataaccatcat
tgtaaagcagaaaggctagtagagaacataggtgatccactggcctcaatgtttgatatg
agtggaataaaagaatgtaaggatcgggaccaagtctcccacgaggaaagaacacgggaa
aggcaaaatcaagaaatcttttgtgatgaagagtcactatctgaagtacaaataggtgtt
tcagaatctataaagaagttttgtgaagatggcatttacttattggatgctactaaagaa
ggaaatgtgggtcgcttcctgaatcatagttgtaacccaaatctcttcgtacagaatgtt
tttgtggagactcatgacagaaactttccatgggtggcattcttcacaaaaaggcatgtg
aaggcaggaacggaactcacgtgggattatggttatgaagctgggagtatacctgagaaa
gagattccttgtcaatgtggctttcacacttgtagaaaaagaataactccgggacgcgga
gccgggcacctccccttctcccgcatgtcttccccaaccccaactgagctctccctggag
gagccaggtctggccctgtcaatcatggcgacggacgaggccctaagagaccccgcaggg
atcttccaggaaaggatggtaaaaataacttgtgatctctgtccacaagatgatgaacgt
ggcatactgtacgtctcacaggatcttgaatgtgtagcacatcaaaattgtttgttatat
tcttctggacttgtagaatctgaggggaatcatccttgtttaaatgaggaagacagaaat
tttgatgtgaagctagtaaatgaggaaatcagtcgaggaaagagactgaaatgttcattt
tgccttcggaaaggagctactgtgggatgtgacattaaaaaatgtcccaagaattaccat
ttcttttgtgccagacaggaccacgccatactgaaagctgatgactctattggaatttac
agagtgttctgccaaaaacatgctactggatcaagtaaccttgatttgctgaagaagatg
aaaaaagctggacttattgaaaatctatttgaagcacttttagaagatcttgatgggatt
cattccaagattaatgacaccaccacttccgaaaaagaattacaagaaattgcaacctca
ctctttgactgtgccatatttaaaaaaacactcaagaaattgtctacagagactgtgata
aagaaacttcagagggaacaggtacagttacagaggaagatagaagtgctccaaggcatc
agagaacgcatgcctcttcctcaggaagatagcatcaaacattcagctggcccttga

DBGET integrated database retrieval system