KEGG   Monodelphis domestica (opossum): 100030812Help
Entry
100030812         CDS       T01031                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100030812 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
1
AA seq 816 aa AA seqDB search
MTDGSRSDVGRWGMSSWQPSVTPSPEPEPDTRSRSGRSFWARCCSCCSCRGGGDDDWGPE
PAGPRGGSGSRGSGSRGSGSRGGSGRPGSRGSGGNAGHAAGTGAARDGMLVVTGVDLMCT
RSDQNRREHHTEEYEYDDLIIRRGQPFCLTVSLSRPYSSSDKMALELLIGANPEIGKGTH
VIIPVGKGGSGGWKAQVLKSNGQHVDLKVHVSPNAIVGKFRFTVRTRTEAGEYQMPFDPK
NEIYILFNPWCPDDPVYVEHENWRHEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDA
CLYILDRRGMPYAGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVE
ILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGIATRTVTNYNSAHDTDTSLTMDIYFDEN
MKPLEHLNHDSVWNFHVWNDCWMRRSDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESV
KNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLICTKAVGSNMREDI
THIYKHPEGSDAERKAVETATAHGSKPNVYATRDSSDDVSVQVETQDAVMGQDLLLCVVL
TNRGSSRRTVKLHLYLSVTFYTGVTGSVFKDSKKEVAISPGSSERVTLPVAYSEYRPHLV
DQGAMLLNISGNVKENGQMIAKQHTFRLRTPDLSLTVLGAAVVGQETEVQIIFRNPLPVT
LTKVVFRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGRRQLIASLDSPQLSQVHG
VIEVDVAPASGGGFFSSDRGSSRSGENIPMAPRGGA
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgggtctcgctctgatgtggggcgatggggtatgagctcctggcagcccagt
gtcacaccttctccggagccagaaccagacaccagatcccggtcaggacgctccttctgg
gcccgatgctgcagctgctgttcctgccgaggtggaggtgatgatgactggggcccagag
cctgcaggcccccgaggaggttcagggtctcgaggctcggggtctcgaggctcaggatct
cgaggaggctctggtcggccgggctctcgaggcagtggaggcaatgcaggccatgcagca
ggcaccggcgccgcccgagatggcatgctggtggtgaccggggtggacctgatgtgtact
cgatctgatcagaaccggcgggaacaccacacggaggagtacgaatatgatgacctgatt
attcgacgggggcagcctttctgcctcaccgtcagcctgtcccggccctactcatcttcg
gacaaaatggcccttgagctgcttatcggtgccaaccctgaaataggaaagggcacgcat
gtgatcatccctgtgggcaaggggggcagtggaggctggaaggcccaggtgctcaagtcc
aacgggcagcatgtggacctaaaggtccatgtatcccccaatgccatcgtgggcaagttc
cgcttcactgtccgcactcgtacggaggccggagagtaccagatgcccttcgaccccaaa
aatgagatctacatcctcttcaacccttggtgtcctgatgatcctgtgtatgtggaacat
gaaaactggcgtcatgagtatgtgcttaatgaatctggtcgcatttactatggcacagag
gcacagattggagagcgcacctggaactacggccaatttgaccatggagtactagatgcc
tgtctctacatcttggaccgaagaggaatgccctatgcagggcggggggaccctgttagt
gtgtcccgtgtcatttctgccatggtgaactctctagatgacaatggagtgttgatcgga
aactggtctggggattactccagaggcactaacccctcggcttgggtgggcagcgtggag
atcctcctgagttaccttcgaacgggctactctgtcccctatggccagtgctgggttttt
gctggtgttaccaccacagtgctccgatgcctcgggattgccaccaggactgtcaccaac
tataactcagctcatgatacggacacctccctcaccatggacatttattttgatgagaac
atgaagccactggaacacttgaaccacgattctgtctggaactttcatgtctggaacgac
tgttggatgagacggtcagacctgccctcaggctttgatggctggcaggtggtggatgcc
accccccaggaaaccagcagtggcatcttctgttgtggcccctgctcagtggagtctgtt
aagaatggcctggtctacatgaaatacgacacgcctttcatctttgccgaggtgaacagt
gacaaagtctactggcaacggcaggacgacggcagcttcaagatcgtctacgtggaagag
aaggccattgggaccctcatctgcaccaaagccgtgggctccaacatgagggaggacatc
actcacatctacaagcatcctgaaggatctgatgcagagaggaaggcagtagagacggca
acagcccatggcagcaaacccaatgtatatgcaacccgggactcatcagatgatgtgtcc
gtccaggtggagacacaagatgctgtgatgggacaagacctcctgctctgcgtggtgctg
accaaccgtggaagcagccggcgtactgtaaaattacacctctacctctccgtcaccttc
tacactggtgtcaccggctccgtcttcaaagacagcaagaaggaggtggcgatatcccct
ggaagctctgagcgcgtgacattgccggtggcttactcagagtaccggccgcatctggtg
gatcagggagctatgctgctgaatatatcaggaaacgtaaaagagaatgggcagatgata
gccaagcaacacaccttccgccttcgaacccctgacctttcccttacggtattgggggca
gcagtggtgggccaggagactgaggtacagattatcttcaggaatccactacctgtcact
ctcaccaaagtggtcttccgactcgagggctccggactccagaggcccaaggttctcaat
gttggagacattgggggcaatgaaacagtgacgctgcgtcagaccttcgtgccggtgcgg
cctggtcgacggcagctcatcgccagcttggacagccctcagctctcccaggtgcatgga
gtcatcgaggtggacgtggcccctgcttctggcgggggcttcttctccagtgaccggggt
agcagccgctccggggaaaatatcccgatggcgcctcgaggaggagcctag

DBGET integrated database retrieval system