KEGG   Mycobacterium dioxanotrophicus: BTO20_02900Help
Entry
BTO20_02900       CDS       T05102                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mdx  Mycobacterium dioxanotrophicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(632576..633667)
Genome map
AA seq 363 aa AA seqDB search
MPPVSPMLSKSLAAIPAGMSYEPKWDGFRSICFRDGDEVEWGSRNERPLTRYFPELVAAA
TAELPPRCVIDGEIVLPTGNGLDFEALQLRLHPAASRVRLLAEQTPAAFIAFDLLALGDE
DYTERPFTERRAALVDALADAGRSIHLTPATTDLETAQRWFAEFEGAGLDGVVAKPLDLT
YQPDKRVMFKVKHQRTADCVVAGYRLHKSGPDAIGSLLLGLYDDDGSLASVGVIGAFPMA
ERRELFTELQPLVTDFEGHPWNWAAHVDEDTQRRYGGSRWNAGKDLSFVPLRPERVVEVR
YDHMEGRPGAGEATGRNLRFRHTAQFNRWRPDRDPRSCTYAQLDQPVTFQLSDIVPGLRA
RRV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcctccggtctccccgatgctctcgaaatcgctggccgcgatccccgcaggcatgtcc
tacgaaccgaagtgggacggcttccggtcgatctgcttccgcgacggcgacgaagtcgag
tggggcagccgcaacgaacgcccgctcacccggtatttccccgaactggtcgcggccgcg
acggcggaactgccgccgcgctgtgtgatcgacggggagatcgtcctgcccaccggcaac
ggcctggacttcgaagcattgcagctgcggttgcacccggccgcgagccgggtgcgcctg
ctggccgagcagaccccggccgcgttcatcgccttcgatctgctcgccctcggcgatgag
gactacaccgagcgcccgttcaccgagcgtcgtgcggccctggtcgatgccctggccgat
gcgggacgctcgatccacctcaccccggcgacgactgacctggagacggcgcagcggtgg
ttcgccgagttcgagggcgccgggttggacggcgtggtcgccaaaccgcttgacctcacc
taccaaccggacaagcgggtgatgttcaaggtcaagcatcagcgcaccgccgactgcgtg
gtggcgggctatcggctgcacaagtccgggcccgacgcgatcggctcgctgctgctcggc
ctctatgacgacgacggctcgctggcctcggtcggtgtgatcggcgctttcccgatggcc
gaacgccgggagctgttcaccgaattgcagcccctggtcaccgatttcgaggggcatccg
tggaactgggccgcgcatgtggacgaggacacgcagcgccgctacggcgggtcgcggtgg
aacgcgggcaaggatctgtcgttcgtgccactgcgacccgaacgggtggtcgaggtgcgc
tatgaccacatggaaggccgccctggggccggcgaagcgacggggagaaatctacggttc
cggcacaccgcgcagttcaaccggtggcggcccgaccgggatccgcgttcatgcacgtat
gcgcagctggaccaaccggtgaccttccagctgagcgatatcgtgccggggctgcgcgcg
cggcgagtgtga

DBGET integrated database retrieval system