KEGG   Mycobacterium dioxanotrophicus: BTO20_03420Help
Entry
BTO20_03420       CDS       T05102                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00010  Glycolysis / Gluconeogenesis
mdx00030  Pentose phosphate pathway
mdx00051  Fructose and mannose metabolism
mdx00052  Galactose metabolism
mdx00680  Methane metabolism
mdx01100  Metabolic pathways
mdx01110  Biosynthesis of secondary metabolites
mdx01120  Microbial metabolism in diverse environments
mdx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mdx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTO20_03420
   00030 Pentose phosphate pathway
    BTO20_03420
   00051 Fructose and mannose metabolism
    BTO20_03420
   00052 Galactose metabolism
    BTO20_03420
  Energy metabolism
   00680 Methane metabolism
    BTO20_03420
Enzymes [BR:mdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BTO20_03420
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BTO20_03420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ART67762
UniProt: A0A1Y0BXY5
LinkDB All DBs
Position
complement(739910..740935)
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRAAVLKGIAVHGLEFVGFLDGWRGVVQGDVIDIPRSMVRGI
AKQGGTILGTSRTNPFENGGGPDVIKGHMDRLGIDSIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCIIAEVMGRHAGWIALHA
GMAAGAHAILIPEQKISVDQITQWVKGAHSRGRAPLVVVAEGFVPEHMESPHSERGLDAF
GRPRLGGIADQLAPEIESRTGIETRATILGHIQRGGVPSAFDRVLATRLGMAAIDSVVAG
YWGTMVALKGTEIEQVSFEEALGNLKAVPQRRYEEAAYLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggaatcctcaccagcggtggcgactgccccggtctgaacgcggtcatccgc
gccgccgtgctcaaaggcattgccgtccacggtctcgaattcgttgggttccttgacggc
tggcgcggcgtcgtccagggcgacgtcatcgacatcccgcgcagcatggtccgcggcatc
gccaagcagggcggcaccatcctgggtacctcccgcaccaacccgttcgagaacggcggc
gggcccgatgtcatcaaaggccacatggaccggctgggcatcgactcgatcatcgccatc
ggcggtgagggaaccttggccgccgccaagcggctcaccgacgccgggctgaagatcgtc
ggtgtcccgaagaccgtggacaacgacctggacgccacggattacaccttcggtttcgat
accgccgtgcagatcgccacggaagcgatcgaccggctgcgcaccacgggcgaatcgcac
caccgctgcatcatcgccgaggtgatgggccggcacgcgggctggatcgcgctgcacgcc
ggcatggcggccggcgcccacgccatcctcatcccggaacagaagatcagcgtcgatcag
atcacccagtgggtgaagggggctcactcccgcgggcgtgcaccgcttgtcgtggtggcc
gaagggtttgtgcccgaacacatggagtccccgcactccgagcgcgggctggacgccttc
ggccgtccccggctcggcgggatcgccgaccagctggcgcccgagatcgaaagccgcacc
ggcatcgagacccgcgccaccatcctgggccacatccagcgtggcggtgtgccctcggcc
ttcgaccgggtgctggccacgcggctgggcatggcggccatcgactctgtggtggccggc
tactggggcaccatggtcgcgctgaaaggcacggagatcgaacaggtgagcttcgaggag
gccctgggcaacctcaaggccgttccgcagcggcgctacgaagaagccgcatacctgttc
ggctga

DBGET integrated database retrieval system