KEGG   Methylobacterium extorquens AM1: Mex_1p4943Help
Entry
Mex_1p4943        CDS       T00921                                 

Gene name
nrtB
Definition
(GenBank) Nitrate transport permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
mea  Methylobacterium extorquens AM1
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Mex_1p4943 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mex_1p4943 (nrtB)
Transporters [BR:mea02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Mex_1p4943 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5069173..5070033)
Genome map
AA seq 286 aa AA seqDB search
MMATGATLTATRERAAKARTPFITLAGLRGVAARVLPPLVVLAGFLLLWEVLCSSPTAGL
PPPSRVVTEAWDIIIDPFYDNGGTDKGLFWHIAASLKRVALGFSLAVVAGVMLGTLVGQS
DWAMRGLDPIFQILRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWPIIINTAVGIRNI
PQDYRNVAAVIRLNPIEFFVKIMLPSAAPYIFTGLRIGVGLSWLAIVAAEMLIGGVGIGF
FIWDAWNSSHISEIIVALVYVGLIGFVLDRMVAGLGVLVTRGTSAA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgatggctaccggagcaacgctcaccgcaacccgcgagcgcgccgccaaggcccgcacg
cccttcatcaccctggccgggctgcgcggcgtcgccgcccgcgtcctgccgccgctcgtc
gtcctggcgggcttcctgctcctgtgggaggtgctgtgctcctcccccaccgccggcctg
ccgccgccctcgcgggtggtgacggaagcctgggacatcatcatcgatccgttctacgac
aacggcggcaccgacaagggcctgttctggcatatcgccgcgagcctgaagcgcgtggcg
ctgggcttctcgctggcggtggtggcgggcgtgatgctcggcacgctggtcggccagtcc
gactgggcgatgcgcgggctcgacccgatcttccagatcctgcgcacgatcccgccgctg
gcctggctcccgctctcgctcgccgccttccgcgacggccaaccgagcgcgatcttcgtg
atcttcatcacctcgatctggccgatcatcatcaacaccgcggtcggcatccgcaacatt
ccgcaggactaccgcaacgtcgccgcggtcatccggctgaacccgatcgagttcttcgtg
aagatcatgctgccctcggcggccccctacatcttcaccggtcttcgcatcggcgtcggc
ctgtcctggctcgccatcgtcgcggccgagatgctgatcggcggcgtcgggatcggcttc
ttcatctgggacgcgtggaactcgtcgcacatctccgagatcatcgtcgccctcgtctat
gtcgggctcatcggcttcgtcctggaccggatggtcgccgggctcggcgtgctcgtgacc
cgcggcaccagcgcagcgtga

DBGET integrated database retrieval system