KEGG   Candidatus Methanoplasma termitum: Mpt1_c07640Help
Entry
Mpt1_c07640       CDS       T03540                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase alpha subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mear  Candidatus Methanoplasma termitum
Pathway
mear00010  Glycolysis / Gluconeogenesis
mear00020  Citrate cycle (TCA cycle)
mear00620  Pyruvate metabolism
mear00633  Nitrotoluene degradation
mear00640  Propanoate metabolism
mear00650  Butanoate metabolism
mear00680  Methane metabolism
mear00720  Carbon fixation pathways in prokaryotes
mear01100  Metabolic pathways
mear01120  Microbial metabolism in diverse environments
mear01130  Biosynthesis of antibiotics
mear01200  Carbon metabolism
Module
mear_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mear00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpt1_c07640 (porA)
   00020 Citrate cycle (TCA cycle)
    Mpt1_c07640 (porA)
   00620 Pyruvate metabolism
    Mpt1_c07640 (porA)
   00640 Propanoate metabolism
    Mpt1_c07640 (porA)
   00650 Butanoate metabolism
    Mpt1_c07640 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpt1_c07640 (porA)
   00680 Methane metabolism
    Mpt1_c07640 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpt1_c07640 (porA)
Enzymes [BR:mear01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpt1_c07640 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AIZ56647
UniProt: A0A0A7LED4
LinkDB All DBs
Position
complement(807053..808219)
Genome map
AA seq 388 aa AA seqDB search
MKQEDIAINGDSAIALAWKQINPDVVAAYPITPQTIIVEKYSEYVADGHVSTEFVCVESE
HSALTLCTTSSSAGARTFTATASQGLAFMWEMLPIAASMRVPLVMAVANRAVSGPIDIHN
DHGDVMSARDCGWISLFSENVQEAYDLSIMATRIAEHHSVQLPVLVNLDGFILTHAIERI
TPLDEKDVRKFVGEFKPLHPLLDVKHPVSHNLMDGPMFYFPHKYQMVVAMHHVPKVAQDV
FNDFEKISGRKYKIVEEYKCDDAEYIAIVLGSTFGTMKEAVDQLRKEGKKVGVAMPRMFR
PWPIAELAKLMKGKKAVIVMDKHLSIGSYGPMFPEVVAAALENESMPKMYNYIYGLGGAD
TMVSDFISVFRDVEKGKAKRINYLGVKE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggaagatatcgcaataaacggcgactctgcgatcgcactcgcatggaaacag
ataaatcccgatgtggtcgcggcatacccgatcacaccacagaccataatagtggagaaa
tactcagaatatgtcgccgacggccatgtttcgacagagttcgtctgcgtagagtctgaa
cacagcgccctcacgctttgtacgacatcctcatccgcaggggcgaggacattcactgcg
acggcctcacagggactcgcgttcatgtgggagatgctgccgatagcggcctcgatgagg
gtcccattggtaatggcggtcgccaacagggcggtcagcggtccgatcgacatccacaac
gaccacggtgacgtaatgtccgcaagggactgcggatggatatcgttgttctccgagaac
gttcaggaagcgtacgacctgtcaataatggcaacgaggatcgccgaacaccacagtgtt
cagctgccggtgctggtcaatcttgatggattcatacttactcatgcaatagagaggata
actcccctcgacgagaaagatgtcaggaagttcgtcggagagttcaagcctctgcacccg
cttcttgacgtgaagcacccggtctcccacaacctgatggacgggccgatgttctacttc
ccgcacaaatatcagatggtcgtggcgatgcaccatgtgcctaaggtggcgcaggacgtg
ttcaacgatttcgagaagatatccggcaggaagtacaagatcgtcgaggaatacaagtgc
gatgatgcggaatatatcgctatcgtcctcggatccactttcgggactatgaaggaggcg
gtcgatcagctgcgcaaggaaggaaagaaagtcggagtagcgatgccccgcatgttcagg
ccgtggccgatcgcagagctggcaaagctcatgaaaggaaagaaagcggtcatcgttatg
gacaagcacctgagcatcggatcatatggcccgatgttcccggaggtcgtcgccgcagca
ctggagaacgagagcatgccgaagatgtacaactacatctatggacttggcggagcggac
acaatggtctccgatttcatttcagtattcagggatgtagagaagggaaaagcaaagagg
atcaactacctgggggtgaaagaatga

DBGET integrated database retrieval system