KEGG   Methylobacterium sp. PR1016A: CS521_00890Help
Entry
CS521_00890       CDS       T05184                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mee  Methylobacterium sp. PR1016A
Pathway
mee00010  Glycolysis / Gluconeogenesis
mee00020  Citrate cycle (TCA cycle)
mee00620  Pyruvate metabolism
mee01100  Metabolic pathways
mee01110  Biosynthesis of secondary metabolites
mee01120  Microbial metabolism in diverse environments
mee01130  Biosynthesis of antibiotics
mee01200  Carbon metabolism
Module
mee_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mee00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CS521_00890
   00020 Citrate cycle (TCA cycle)
    CS521_00890
   00620 Pyruvate metabolism
    CS521_00890
Enzymes [BR:mee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CS521_00890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ATU37436
LinkDB All DBs
Position
186531..187841
Genome map
AA seq 436 aa AA seqDB search
MSASLPVALPDIGDFKDVPVVEILVKPGDRIAVDDLLISIESDKATMEVPSPVAGVVTEI
LVAPGTRVSQGTTILMVDTSGEGAAPQPAPAAPPIPAPQASPAAPAPAPAAPATAVPAPD
VAASSDIHATPSVRAYARELGVDLAGIPGTGPQGRILREDVLAFVRGQMAVPSPAAAPAA
SPPPAAASPSGIGAGLPAWPQVDHGKFGPVRRESLSRIQQISGQALARNWLTIPHVTNFD
HADVTETEALRRELNGAARPGSHKVTMVAILIKAAAAALRAYPRFNAALDGDAVILKDYV
HVGFAVDTPRGLLVPVVRDCDRKGLVEIAQEMGELAEQARSGTLPPSAMQGGGFSVSSLG
GIGGDGFTPIINAPEVAILGAARSRIEPVWDGSTFQPRLILPVSLSWDHRAVDGAAAARF
LSHLAAVLTDLRRGAL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccagcctgccggtcgccctgcccgatatcggcgacttcaaggacgttccggtg
gtcgagatcctggtcaagccgggggaccggatcgccgtcgacgacctcctgatcagcatc
gaatccgacaaggccaccatggaggtgccctcgccggtggcgggcgtggtgacggagatc
ctggtggcgccgggcacccgggtgtcgcagggcacgacgatcctgatggtcgatacgtcc
ggcgagggcgccgcgccccagccggcacctgcggccccgccgattcccgcgccgcaagcc
tccccggcggcgcctgccccggcccctgctgctccggcgacagctgttcccgcgcccgat
gtcgccgcctcgtccgacatccacgccacgccctcggtgcgcgcctatgcgcgcgagctc
ggcgtcgatctcgcgggcatcccgggcaccggcccgcaagggcgcatcctgcgcgaggac
gtgctggccttcgtccgcggccagatggcggtcccctcccccgccgcagcgccggccgcc
agcccgccgcccgccgccgcgtcgccctccgggatcggcgccggcctgccggcctggccg
caggtcgatcacggcaagttcggcccggtgcggcgcgaatcactctcgcgcatccagcag
atctccggccaggcgctcgcccgcaactggctgacgatcccgcacgtcaccaatttcgac
cacgccgacgtcaccgagaccgaggcgctgcggcgcgagctgaacggcgccgcgcggccg
ggcagccacaaggtcacgatggtggcgatcctgatcaaggccgccgccgccgcgctccgg
gcctatccgcgcttcaacgcggcgctcgacggcgatgccgtgatcctgaaggactacgtc
catgtcggcttcgcggtcgacacgccgcggggcctgctggtgccggtggtgcgcgactgc
gaccgcaagggcctcgtcgagatcgcccaggagatgggggaactggccgagcaggcccgc
tccggcacgcttcccccttcggccatgcagggcggcggcttctcggtctcctcgctcggc
ggcatcggcggcgacggcttcacgccgatcatcaacgcgcccgaggtggcgatcctgggg
gcggcgcgctcgcgcatcgagccggtctgggacggcagcaccttccagccgcggctgatc
ctgcccgtgagcctgtcctgggaccaccgggcggtggacggcgccgccgcggcccgcttc
ctctcccacctcgccgccgtgctcaccgacctgcgccggggcgccctgtga

DBGET integrated database retrieval system