KEGG   Methylobacterium sp. PR1016A: CS521_20685Help
Entry
CS521_20685       CDS       T05184                                 

Definition
(GenBank) acyl-phosphate glycerol 3-phosphate acyltransferase
Organism
mee  Methylobacterium sp. PR1016A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Acyltransferase PP-binding TT_ORF2a
Motif
Other DBs
NCBI-ProteinID: ATU42754
LinkDB All DBs
Position
4473001..4475775
Genome map
AA seq 924 aa AA seqDB search
MGVIGSLLGELHPDRRRAVPVDLDSDLERDLGLDSLGRAELLLRLSRTFRVSLPARLIGE
AATPADLLAAIQAAGMARIVRVAASGEGTLPPAAEPHRAATLIEVLAFHVRHHPDRPHLR
LLQEGGSETVLSYAELDRRARRVAAGLLGRGLAGGDRVAIMLPTGPGFFTAFLGILLAGG
VPVPLYPPFRRTGIQDHLQRQAGILANAAPEILIGSAELGPFGRLLRDRVDTLRVLTSVE
ELAAADPLAAAVPVTGASLALIQYTSGSTGDPKGVMLTHANLLANIRAMGEALGASSSDV
VVSWLPLYHDMGLIGCWLGSLYFGARAVILSPLAFLADPAAWLRAIHQHRGTISAAPNFA
YELCLRALRDEDLTGLDLGSLRVLTNGAEAVSPHTLARFAERFGPHGLRASALAPVYGLA
ECAVGLAFPPLGRGPRIDWIDRAALAREGAARTAPPGAPGAVGFPACGGPLRGHQIRVVD
EAGHELPERREGRLQFRGPSATTGYFRRPDLTRTLFCGDWLESGDLAYLAGGEVHVTGRT
KDIIIRAGRKIHPHEIEAAAGEVEGVRKGCVAAIASRDPRTGTERLILVAETRLTEPDAR
ADLHGRLMRATAALLDQPPDEIVLCPPHTVPKTSSGKIRRAALRALSESGDLRGPRPGPR
GELARLALGSLRARLRRSARLAGEAAYAAAWWGLVVAFGAVLWLLVLVLPTRPARHAALR
SGLRGFFRLAGMPLLTEGGPVPPGALVVANHASYLDAAVLAAILPGTPAFVAKHELAGQR
VAGPFLRRLGAAFVHRGTAEGVADAGTLIDRIRAGEQLVAFPEGTFTRAPGLCGFHLGAF
AAACRAGIPVVPVAIAGTRSRLRADQWFPRRGTIRVAIGAPVAPDGTDFPAAIRLRDAVR
GVVLAQCGEPDLGAGTTAAPGTEA
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgatcgggtcgctcctgggcgaactgcaccccgatcgccgccgggcggtcccg
gtcgacctcgacagcgacctcgaacgggacctcggcctcgacagcctcgggcgggccgag
ctcctcctgcgtctctcgcgcaccttccgggtctcgctgccggcgcgcctgatcggcgag
gctgcgacccccgccgacctgctcgccgcgatccaggcggccggcatggcccggatcgtc
cgggtggccgcatcgggggaggggacattgcctccggcggccgagccgcatcgggccgcg
accctgatcgaggtgctcgccttccacgtccgccatcatccggaccggccgcatctccgg
ctcttgcaggagggcggatccgagaccgtcctctcctatgcggaactcgaccgacgcgcc
cgccgcgtcgcggccggcctcctcggccgcgggctcgcgggcggcgaccgggtcgcgatc
atgctgccgaccgggcccggcttcttcacggccttcctcgggatcctcctggcgggcggc
gtgccggtgccgctctatccgccgttccggcgcaccgggatccaggaccacctgcagcgc
caggccggcatcctggccaatgccgccccggagatcctgatcggaagcgccgagctcggg
cccttcggccggctcctgcgcgaccgcgtcgacacgctgcgggtgctgacgagcgtggag
gagctggccgccgccgacccgctcgccgccgccgttccggtgacgggcgcgagcctcgcg
ctcatccagtacacgtcgggcagcaccggcgacccgaagggcgtgatgctgacccatgcc
aacctgctggccaatatccgcgccatgggcgaggcgctcggcgcctcgtcgtcggacgtg
gtggtgagctggctgccgctctaccacgacatggggttgatcggctgctggctcggcagc
ctctatttcggcgcgcgggcggtgatcctgtcgccgctggccttcctggcggatccggcg
gcgtggctccgggcgatccaccagcatcgcggcacgatctcggccgcgccgaacttcgcc
tacgagctctgcctgcgcgccctgcgcgacgaggacctgacggggctcgatctcggctcc
ctgcgcgtcctcaccaacggggccgaggcggtgagcccccacacgctagcgcggttcgcg
gagcgcttcggccctcacggcctgcgggcgtcggccctcgcgccggtctacggcctcgcc
gaatgcgcggtcggccttgcctttccgcccctcggccgcggcccgcgcatcgactggatc
gatcgcgcggcgctcgcccgcgagggcgcagcccggacggcgccgccgggtgcgcctggc
gccgtcgggtttccggcctgcgggggccccctgcgcggccaccagatccgcgtcgtcgac
gaggccgggcacgagctgcccgagcgccgggagggccgcctgcagttccggggcccctcg
gccacgaccggctacttccgccggcccgacctgacccgcaccttgttctgcggcgactgg
ctcgagagcggcgacctcgcctacctggcgggcggcgaggtccacgtcaccgggcggacc
aaggacatcatcatccgggcaggccgcaagatccatccgcacgagatcgaggcggcggcg
ggcgaggtcgagggcgtgcgcaagggctgcgtcgcggccattgccagccgcgacccgcgc
accgggaccgagcgcctgatcctcgtggccgagacgcgcctgacggagccggacgcacgg
gcggacctgcacggccggctgatgcgggccaccgccgccctgctcgaccagccgcccgac
gagatcgtgctgtgcccgccccacaccgtgcccaagacctcgagcggcaagatccgccgc
gcggccctgcgggcgctctccgaatccggtgacctccgcggtccacgaccgggcccgcgg
ggcgagcttgcccgtctggccctcggcagcctccgggcgcggctgcggcggagcgcccgg
ctcgccggcgaggcggcctacgccgccgcctggtgggggctcgtggtcgcgttcggcgcc
gtcctgtggctgctggtcctcgtcctgccgacgcggcctgcgcgccacgccgccctgcgg
tcgggcctgcggggattcttccggctcgccgggatgccgctcctgaccgagggcggtccc
gtgccgcccggggcgctcgtcgtggccaaccacgcgagctacctcgatgcggcggtcctc
gccgcgatcctgcccggcaccccggccttcgtcgccaagcacgagctggccggccagcgc
gtcgccggcccgttcctgcggcgcctcggcgcggccttcgtccatcgcggcacggcggag
ggagtcgccgatgcgggcacgctcatcgaccggatccgggcgggcgagcagctcgtagcg
tttcccgagggcaccttcacccgcgcgccgggcctgtgcggcttccatctcggcgccttc
gcggcggcctgccgggcgggcatccccgtcgtgccggtggcgatcgccggcacgcgctcg
cggctgcgggccgaccagtggtttccccggcgcgggacgatccgcgtcgccatcggcgcg
ccggtcgccccggacggcaccgacttcccggcggcgatccgcctgcgcgatgcggtgcgc
ggggtcgtcctggcgcagtgcggcgagccggacctcggcgccggcacgaccgccgcaccc
ggcacggaggcctga

DBGET integrated database retrieval system