KEGG   Methanosarcina sp. WH1: MSWH1_0344Help
Entry
MSWH1_0344        CDS       T03851                                 

Definition
(GenBank) Alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mef  Methanosarcina sp. WH1
Pathway
mef00500  Starch and sucrose metabolism
mef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mef00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MSWH1_0344
Enzymes [BR:mef01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MSWH1_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: AKB20615
UniProt: A0A0E3NN94
LinkDB All DBs
Position
398614..399750
Genome map
AA seq 378 aa AA seqDB search
MKAVCMCVGVHLPYSPKWYWPVQGFSGVPEMDRYFDRNQIFSRLLNTGRELLRLNDLFLE
SIERGGSYTFDLSGPFLEQCRWDPELIESFRELAECRKAEFTGSCFYHSLSALYPDLSWF
REEVTSHRELLRELLGVNPETFVNTELLYTERVESILTDLGFRCLIAEGSRNILDGYDPI
RVFENHLPTLLRHINLSEDLELRFSEKNWEGYPLIPDKFADWIASMEGDVLTLYLNYTSL
CLHHRSKSMIADFIRVFPEALKSRGIEMITPSDAVSRFSPVRLPTLGTEQTIRYGMHNAV
GNHAQQLYLRELVRVGEELAEIKEKKNYQKLKQVFGYLQQSEILFSMNTGNVREGSERAV
NYYSILSDLRRAVLEEGA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtgtgcatgtgtgtgggagtgcatttgccttacagtcccaagtggtattgg
cccgtacaggggttttccggagttcctgaaatggatcggtattttgaccgaaaccaaatt
ttttcaaggctcttaaacacaggcagagaacttctgcgccttaatgatctttttctggaa
tccattgaaagggggggaagctacacctttgacctttcagggcctttcctggaacagtgc
aggtgggacccagaacttattgaatctttcagggaacttgcggagtgcagaaaggcagag
tttacaggaagctgtttttatcattctctgagtgccctttatcccgatctctcctggttt
agagaggaagtaacgagtcacagggaactgctcagggaactgttaggggtaaaccctgag
actttcgtgaacacggaacttctatacacggaaagggtggaaagtatacttacagatctg
ggtttcaggtgccttattgccgaagggtcacgaaacattctggatggatatgatcccatc
cgcgtttttgaaaaccaccttccgactcttctcaggcacataaacctgagtgaagacctt
gaactgcgtttctctgaaaaaaattgggaaggttatcctctgattccggataagtttgca
gactggattgcaagcatggaaggggatgtcctgaccctttatttaaattatacaagcctc
tgccttcaccacaggagtaagagcatgatagccgattttatacgggtttttccggaagct
ctgaagagccggggcattgaaatgatcacaccttcggatgcagtaagcaggttcagtcct
gtgagacttcctactcttgggactgaacagacaatccgttacggaatgcataacgctgtc
ggaaaccatgcacagcagctctacctgagggagctggtaagggtaggggaagaacttgca
gaaattaaagaaaaaaagaactatcaaaagctgaagcaggttttcggttatctccagcag
agtgaaattcttttttctatgaatacgggaaacgtccgtgaagggtctgaaagagctgtg
aattactattccattctctcggatttaagaagagccgttctggaggaaggggcatga

DBGET integrated database retrieval system