KEGG   Methylotenera versatilis: M301_2396Help
Entry
M301_2396         CDS       T01247                                 

Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
meh  Methylotenera versatilis
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:meh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M301_2396
   01230 Biosynthesis of amino acids
    M301_2396
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M301_2396
   00620 Pyruvate metabolism
    M301_2396
  Nucleotide metabolism
   00230 Purine metabolism
    M301_2396
Enzymes [BR:meh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     M301_2396
Exosome [BR:meh04147]
 Exosomal proteins
  Proteins found in most exosomes
   M301_2396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2638062..2639498)
Genome map
AA seq 478 aa AA seqDB search
MTLRKTKIVATLGPSSNSEEMLARMIMAGVNVVRLNFSHGSAEEHINRAEMVRAIALKLN
RPIGVLCDLQGPKIRIGKFELGKITLKTGDIFILDSDCQLGNQDHVGLDYKTLPQEVVEG
VILLLDDGRITMQVDRVKGNQIHCLVMNGGVLSNNKGINRLGGGLSAEALTEKDREDILT
AVALEADYVALSFPRTALDVELARILVQQAGGKASIVAKIERAEAIDNLESIIDASDAIM
VARGDLGVEVGDAAIPGLQKRMIRMAREQNKLVITATQMMESMITSPIPTRAEVSDVANA
VLDGTDAIMLSAETAAGQYPLESVQAVHRVVMEAEKEYYIQPHVRRVEQVFLRTDEAIAS
AAIYTAQHLKVKAIAALTQSGNAAQWLSRADSEMPIYALSPDKYARRKLTLHRGVYPFPI
EQGAKNRDEILQEMEQVLLQQKAVNLGDLVLLTFGEPIGSPGGTNTLKIVKIGENKQA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
ttgacattacgtaaaacaaaaattgttgcaacactaggcccatcctcaaacagcgaggaa
atgctggcacgcatgattatggctggtgtaaacgtagtgagattaaacttttcgcatggt
agcgcagaagagcatattaatcgggcagaaatggtacgtgcgattgccttgaaattaaac
cgcccgataggcgtgttgtgtgatttgcaaggtcccaaaatacgaattggtaagtttgaa
ttgggtaaaatcactttaaaaactggtgacatttttatattagattctgattgtcagtta
ggcaatcaagatcatgtcggtttggattacaaaaccctgccacaagaggtagtagagggc
gttattctactattggatgatggccgtattaccatgcaagtggatagagtaaaaggcaat
cagattcattgcttggtgatgaatggcggcgtattgagcaacaataaaggcattaatcgc
cttggtggtggtttatcagccgaagcgctcacggaaaaagatcgtgaagatattctaaca
gccgtagcattagaagctgattatgttgctttgtctttcccaagaacggctttagatgta
gagcttgcgcgcatcttagtgcagcaagctggtggtaaagcgagtattgttgccaaaatc
gagcgtgcagaagcgattgataatttagaatctattattgatgcgtcagatgcgattatg
gttgctcgaggcgacttgggcgtggaagttggcgatgctgctattccaggcttgcagaaa
cgcatgatacgcatggcgcgtgagcaaaacaaattagtgatcaccgccacgcaaatgatg
gagtctatgattaccagcccgattccaacgcgtgctgaagtttctgatgtcgctaatgcc
gtgttggatggcactgatgcgattatgctatcggctgaaacggcggcagggcagtatcca
ttagaaagcgtgcaggcggtgcatcgcgtagtgatggaggctgagaaagaatattatatt
cagcctcatgtgcgcagagtggagcaagtatttcttaggactgatgaagcgatagcctct
gctgcaatttatacggcgcagcacttaaaagtgaaggcgattgctgcacttacgcaatct
ggaaatgcagcacaatggctatctcgtgcggattcagagatgcctatctatgcactttca
ccagataaatatgcgcgtagaaagcttaccctgcaccgcggtgtttatccatttcctatt
gagcaaggcgctaaaaatagagacgaaattctgcaggaaatggagcaggtcttattgcaa
caaaaagcggttaatttaggcgatttggttttactcacattcggtgagccgattggcagt
ccgggcggtacaaatacacttaaaatagtgaaaattggtgagaataaacaagcctag

DBGET integrated database retrieval system