KEGG   Methanoculleus sp. MAB1: MMAB1_1769Help
Entry
MMAB1_1769        CDS       T04314                                 

Gene name
lig
Definition
(GenBank) DNA ligase (ATP)
Organism
mema  Methanoculleus sp. MAB1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
chrI:complement(1422975..1423538)
Genome map
AA seq 187 aa AA seqDB search
MSRPDDSHGKGEVARTPGDCPIFVIQKHDATTLHYDFRLEADGVLKSWAVPKGPSTDPKE
KRLAVPTEDHLLDYADFEGVIPEGGYGAGTVMVWDRGTYRNLTRKGGEEVSVTEALRRGH
VSVWLEGEKVRGGYALTRFRTGKGEAWLLVKMDDAEAAPDRDLVATEPRSVVSGRTIEEI
AAGEGSA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcctgacgattcccacgggaagggggaggttgcccggacgccgggagactgc
ccgatctttgtcatccagaagcacgatgcgaccacgctccactacgatttccgcctggaa
gctgatggcgtgctgaagtcctgggcagtcccgaaggggccgtccacggacccgaaggag
aaacgcctcgccgtccccacagaagaccacctcctcgactacgccgattttgagggcgtc
atcccggaggggggttatggggccgggacggtcatggtctgggaccgggggacctatcgg
aacctcacccggaagggcggagaggaggtttcggtcaccgaggcgctcaggcggggccac
gtatcggtctggctcgagggggagaaggtcaggggcgggtatgccctcacccggttcagg
accggaaagggcgaggcctggctcctcgtgaagatggacgacgctgaggcggcgccggat
agggacctcgtggcaacggaaccccggtcggtcgtctccgggcggacgatcgaggagatc
gcagcgggggagggttcagcatga

DBGET integrated database retrieval system