KEGG   Methanoculleus sp. MAB1: MMAB1_2868Help
Entry
MMAB1_2868        CDS       T04314                                 

Gene name
rbcL
Definition
(GenBank) Ribulose bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mema  Methanoculleus sp. MAB1
Pathway
mema00630  Glyoxylate and dicarboxylate metabolism
mema01100  Metabolic pathways
mema01120  Microbial metabolism in diverse environments
mema01200  Carbon metabolism
Module
mema_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mema00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MMAB1_2868 (rbcL)
Enzymes [BR:mema01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MMAB1_2868 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CVK34081
UniProt: A0A0X3BPV0
LinkDB All DBs
Position
chrI:2315076..2316269
Genome map
AA seq 397 aa AA seqDB search
MAIDWYEEFVDTDHTPGPDELVALYYFEPAAGISKEEAVGRIASESSTGTWTTLFTMPPR
MRDLQAKAFEIEGNYVKIAYPLALWEEGNAPQLLSGIAGNVFGMKALESLRLIDASLPAD
YLRHFKGPHFGMEGIRDMMKVHGRPLTGAVPKPKVGFTAEEHAEVGYETWMGGFDFVKDD
ENLTSLSFNRFEDRVRAMTTMRDRAEQETGDVKSAFINITADTETMKKRAEMLADYGWNY
AMIDVVVTGTAAVATLRDHCSDLGLAIHAHRAMHAAFDRDEKHGITMQFLAKIMRLIGVA
QIHTGTAVGKLVGTKAEATVLADMVREKHTNAVDHMALDQDWGAIKSAFPVSSGGLHPGL
VPDVLDIYGSDLVLLVSGGIHGHPKHAGRRHGHHAGN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgactggtatgaagaatttgttgacacagaccacactcccggtccggatgag
ctcgtagccctctactacttcgaacccgcggccgggatcagcaaggaggaggcggtcggg
agaatcgcatccgagagctcgaccgggacctggacaacgctctttaccatgcccccccgg
atgcgggacctccaggcgaaggcgtttgagatcgaagggaactatgtgaagatcgcatac
cccctcgccctctgggaggagggcaacgctccccagctcctgagcggcatcgccgggaac
gtctttgggatgaaggcgctcgagagcctgcggctgatcgacgcctcgctcccggccgac
tacctccggcacttcaaggggccgcacttcggcatggaggggatccgggatatgatgaag
gtccatggccggccgctcacaggggcggtgccgaagccgaaggtggggttcaccgcagag
gagcacgctgaggttggttatgagacctggatgggcgggtttgacttcgtgaaggacgac
gagaacctgacatctctctcgttcaaccggttcgaggaccgtgtccgggccatgacaacg
atgcgtgaccgggctgagcaggagaccggtgacgtgaagtccgcgttcatcaacatcacg
gccgatacggagacgatgaagaagcgggcggagatgctcgcagactacggctggaactac
gccatgatcgatgttgtggtgaccgggaccgccgcggtcgcgaccctccgggaccactgc
tccgacctcgggcttgcgatccacgcccaccgggcgatgcacgcagccttcgaccgggat
gagaagcacgggatcacgatgcagttcctggcgaagatcatgcggctcatcggtgttgcg
cagatccacaccgggaccgccgtcgggaaactggtcggcacgaaggcggaggctacggtg
cttgccgatatggtccgggagaagcatacgaacgcagtggatcacatggccctcgaccag
gactggggcgcaatcaagagtgcgttcccggtctcgtcgggcgggctccaccccgggctc
gtgccggacgtccttgatatctacggcagcgacctcgtcctcctggtgagcggcggcatc
cacggccacccgaagcacgcgggccggcgccatggccaccatgcaggcaattga

DBGET integrated database retrieval system