KEGG   Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1: MMINT_00470Help
Entry
MMINT_00470       CDS       T02692                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mer  Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
Pathway
mer00620  Pyruvate metabolism
mer00680  Methane metabolism
mer00720  Carbon fixation pathways in prokaryotes
mer01100  Metabolic pathways
mer01120  Microbial metabolism in diverse environments
mer01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mer00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMINT_00470
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MMINT_00470
   00680 Methane metabolism
    MMINT_00470
Enzymes [BR:mer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MMINT_00470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGN25463
UniProt: R9T7Y4
LinkDB All DBs
Position
47846..49219
Genome map
AA seq 457 aa AA seqDB search
MGGEDEIQEAYYVFSHLECDEQMWDCEGKEVDNFVVKKLLSKYEWYFREKQIGKDLFLTL
RVPNPTVEKDEAKILLETLESIPRSFDTAQLFYQNDIPPIFEVILPMTSSALSLDRVYSY
YRNFVVGKQHMLFDDSTPVSDWIGTFEPEAINVIPLFEDLDHMLDAHNITEKYISGKNLD
YQRVFLARSDPAMNYGDLSAILMNKIALYNLQELQERSGVEIFPIIGVGSAPFRGDLKPD
NVNEIMEEYPSVQTFTVQSAFKYDNSNEKVRSGIQQLNDSCKKNAHEIDQQQAEDIITRC
STSYRKRLVKLAPLICEVSNYVPRRRKRKLHIGLFGYSRSMEGVKLPRAIGFCCALYSLG
IPPELLGMDALTEKDLDFVRDVCPHFDTSMRSALQFMNPDILSSMPDIAKAVDTLSIDYE
TDESHREITSYISSNLRQSKDLGEFVLRAANQRGFLG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtgaagatgagattcaggaagcttattacgtgttttctcacttagaatgtgat
gaacagatgtgggattgtgaaggtaaggaagttgataactttgtggtcaaaaaattgctt
tccaaatatgagtggtatttccgtgagaagcagataggcaaagatctttttcttacattg
cgtgtgcccaatccaactgtagaaaaagatgaagccaagattttgctggaaacgctggag
tcgattccccgttcctttgatactgctcagttgttctatcaaaacgacatcccgcctatt
tttgaagtaatcctgccgatgacttcttcagctctgtcgctggatcgtgtctacagttac
tatcgcaattttgtggtaggtaaacagcacatgctttttgatgattcaacgccagtatct
gactggatcggaacatttgaacccgaagccatcaatgtcatccctctttttgaagatctt
gatcatatgctggatgcacacaatattactgaaaaatacatcagcggcaaaaatctggat
tatcagcgcgtattcctagcccgctctgaccctgctatgaactatggcgatcttagtgcc
atacttatgaacaaaattgctctatataatcttcaagagttgcaagagagaagcggtgtt
gagatattccccataatcggtgttggttcagcacctttcagaggagatctgaagccagat
aatgtaaacgaaatcatggaagaatacccgtccgtgcagacttttacagttcaatccgct
ttcaaatatgataattcaaatgagaaagtccgcagcggcatccagcagctcaatgacagt
tgcaaaaagaacgctcatgaaattgatcagcagcaggctgaggacatcataacgcgttgc
tctacctcctaccgcaagcgtcttgtcaaactagcaccgctcatctgtgaagtttctaac
tatgtcccgcgtaggaggaaaaggaaactgcacattggtctctttggttactcccgcagc
atggaaggtgtaaaactgccgcgggcaatcggcttttgctgtgctttatactctttagga
attccaccagagctgctgggtatggatgctttaacagaaaaggatctagactttgttcgt
gacgtctgcccgcactttgacacgagtatgcgttcggctctgcagttcatgaatccagat
attctcagttcaatgcctgacatcgccaaggccgtagacacactcagtatcgattatgag
actgatgaatcacaccgtgaaatcacctcatatatctccagcaatctgagacagtctaaa
gatcttggtgagtttgtactgcgagcagctaatcaaagaggtttcttaggctga

DBGET integrated database retrieval system