KEGG   Mesorhizobium sp. B7: BSQ44_10600Help
Entry
BSQ44_10600       CDS       T04603                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
meso  Mesorhizobium sp. B7
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:meso00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSQ44_10600
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BSQ44_10600
Enzymes [BR:meso01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSQ44_10600
Peptidoglycan biosynthesis and degradation proteins [BR:meso01011]
 Precursor biosynthesis
  Racemase
   BSQ44_10600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2139988..2141139)
Genome map
AA seq 383 aa AA seqDB search
MREAGTKPHLAGGRLTIDLRSLQANFRALAKVAAPARVAGIVKADAYGIGIAEVVPALAA
VGCDTFFVALPEEGFAVRRAAPQARIFVLNGLFGAEAAEAYAGSQLIPVINTAVDLTIWE
RFCGRQGAAHPCAIHVDTGMNRLGITPAEAIAFADENMLTGTVNPVLLMSHLACADRRDD
PKNRRQLELFRQVRRAFGDMEASLVNSSGLLLGRDYHFGLCRPGIAVYGGSPAPGVTMRT
VVTAEARVVQIRYARAGETISYGATAVLERDSIIAVAAAGYADGFPRAASGSGVPIRQLF
PGGSGFVHGRRVPIVGRVTMDLTMFDVTDLGEDGIATGDHIELFGPNLPLDEAARAAGTI
SYELLTRIGQRYHRAYISGADTR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atccgggaggccgggaccaaacctcaccttgccggcggccggctgacgatcgatctgcgc
tcgctgcaggcgaattttcgcgcgcttgcaaaggtggccgcgccggcccgcgtcgccgga
atcgtcaaggcggacgcctatggcatcggcatcgcggaggtcgtccccgcgctggcggct
gtcggatgcgatacgttcttcgtcgccctgcccgaagaaggcttcgcagtcaggcgcgct
gcgccgcaagcgcgcatcttcgtcctcaacggtctcttcggagcggaggcggccgaggca
tacgccgggtcgcagctgatcccggtgatcaacaccgccgtcgacctgacgatctgggaa
cgattctgcgggcggcagggtgcggcgcacccctgcgccatccatgtcgacaccggcatg
aaccgcctcggcatcacgccggccgaggcgattgccttcgcggacgagaacatgctgacc
ggcacggtcaacccggtgctcctgatgagccatctcgcctgcgccgaccggcgcgacgat
cccaagaaccgcaggcagctcgaactttttcggcaggtgcggcgtgcgttcggggatatg
gaggcgagcctcgtcaattcctcaggcctgctgctagggcgcgattaccatttcggcctc
tgccgccccggcatcgccgtatacggcggatcgcccgcacctggcgtcaccatgcgcacc
gtggtgacggcggaagcccgcgtggttcagatccgctatgccagggccggcgagaccatc
agctacggcgcgacggcggtcctcgagcgcgacagcatcatcgccgttgccgcggccgga
tatgccgacggcttcccgcgcgccgcgtctggcagcggggtgccgatccgccagctcttt
cccggcggaagcgggttcgtgcatggtcgccgcgtgccgatcgtcgggcgcgtgaccatg
gacctgaccatgttcgacgtgaccgacctcggcgaggacggcatcgcgacgggcgatcac
atcgaactcttcgggcccaacctgccgctcgacgaggccgcgcgcgcggcgggaacgatc
tcctacgaactcctcacccggatcggccagcgctaccaccgcgcctacatcagcggcgcc
gatacgcggtga

DBGET integrated database retrieval system