KEGG   Mesorhizobium sp. WSM1497: A9K65_006290Help
Entry
A9K65_006290      CDS       T04915                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mesw00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A9K65_006290
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A9K65_006290
Enzymes [BR:mesw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A9K65_006290
Peptidoglycan biosynthesis and degradation proteins [BR:mesw01011]
 Precursor biosynthesis
  Racemase
   A9K65_006290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1287096..1288235
Genome map
AA seq 379 aa AA seqDB search
MNDAPQKSPPEEVTATSEVAAGAILTIDLGAIRENYRRLKARLGDVACAGVLKADGYGLG
AGQVGAALLREGCDIFFVALLGEGVALRRSLGAGPAIFVLNGIPPGAEPDAVAANLCVVI
YSHEQLAAWRAAARRAGRKLPAAVQVDSGMSRLGMAPRDVDRIAADPQAFDGIDIRYVMS
HLACADEPEHPANEKQRLAFEQLRKMLPAAPASLTNSSGIFLGPSFHYDLARPGAALYGI
NPTPPKSNPMLPVVRLQAKVAQTRSVEKGAGVGYGHTYHAQGPLRLATISFGYADGWQRR
AASAAWFEGVRLPFVGRVSMDSIILDISALPAGRLREGDLVELLGPSQSVDDAAGHAGTI
GYEILTSLGPRFHRRYVGG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgccccccaaaaatcgccgccagaagaggtcaccgccacaagcgaagtggcg
gctggggccatcctcaccatcgacctcggtgcaatccgtgaaaactaccggcggctgaag
gcgcggttgggcgatgttgcctgcgctggtgtgctcaaggcggacggctacggccttggc
gccggccaggtcggggcggcactgctgcgcgaaggctgcgatatcttcttcgttgcgctt
ctgggcgaaggcgtcgccctgcgccgctcgcttggggccggccctgccattttcgtgttg
aacggcattccgcccggtgccgagccggacgctgtggcagcaaacctttgcgttgttatc
tacagccacgagcaactggcagcctggcgtgctgcggcccgccgcgccggccgaaaactg
ccggccgcggtccaggtcgacagcggcatgtcgcggctcggcatggcgcctcgggatgtg
gatcgcatcgccgccgatccgcaggctttcgacggcatcgacatccgttacgtgatgagc
catctggcctgcgccgacgagccggagcatccggccaatgagaagcagcgactggcattc
gagcagctgcgcaagatgctgccggcggcaccggcctcgctgaccaattcctccggcatc
tttcttgggccgtcctttcactacgatctcgcccgccccggtgccgccctctacggcatc
aatccgacgccgccaaagtccaatccgatgctgccggtggtgcggctgcaggcaaaggtg
gcacagacgcgcagcgtcgaaaagggcgccggcgtcggctatggccacacctatcatgcg
caaggcccgctcaggctggcgacgatttcgttcggctacgctgatggctggcaacgccgc
gccgcgtccgccgcctggttcgagggcgtgcggctacctttcgtcgggcgggtatcgatg
gattcgatcattctcgacatttccgccctgccggccggcaggctgcgcgagggtgatctg
gtcgaactgctcggtccctcgcaaagcgtcgatgacgccgccggccatgccggcaccatc
ggctacgagatcctgaccagcctcggcccgcgcttccaccggcgctatgtcggcggttga

DBGET integrated database retrieval system