KEGG   Mesorhizobium sp. WSM1497: A9K65_014475Help
Entry
A9K65_014475      CDS       T04915                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:mesw00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    A9K65_014475
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    A9K65_014475
Transporters [BR:mesw02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    A9K65_014475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3008686..3009576
Genome map
AA seq 296 aa AA seqDB search
MSIQTIEDTKVKAFPAKPAEVIAFTAKARRRFEPLAIAGKLASALVPPIIVIALMLVVWQ
IACSSPTSSLPPPTQVWNEAYDLIAHPFFDNGPQDIGLAWRVLISLQRVAVGFGLAAVVG
VALGALVGQSIWAMRGLDPVFQILRTVPPLAWLPLSLAAFRDSSPSAIFVIFITSIWPII
INTAVGVRNIPEDYRNVSRILRLNQFEFFVKIMVPAAAPYIFTGLRIGIGLSWLAIVAAE
MLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVTGFCLDRLVAAVGAFVTRGTTAK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccagactatcgaggacaccaaggtgaaggcctttcccgccaagccggcggag
gtcatcgccttcactgccaaggcacggcgccgcttcgagccgctcgccatcgccggcaaa
ctggcgagcgcgctggtgccgcccatcatcgtcatcgcgctgatgctggtcgtctggcag
atcgcctgttcgtcgccgacatcgagcctgccgccgccgacccaggtgtggaacgaggct
tacgacctgatagcgcatccgttcttcgacaatggcccgcaggatataggtctggcctgg
cgcgtgctgatctcgctgcagcgcgtcgccgtcggcttcggcctggcggcggtcgtcggc
gtcgcgctcggtgcgctggtcggccagtcgatctgggcgatgcgcggcctcgacccggtg
ttccagatcctgcgcacggtgccgccgctggcctggctgccgctgtcgctggcggcgttc
cgtgattccagcccgtcggcgatcttcgtcatcttcatcacctcgatctggccaatcatc
atcaacaccgcggtcggcgtgcgcaacattcccgaggactaccgcaacgtctcgcgcatc
ctgcggctcaaccagttcgaattcttcgtcaagatcatggtgccggccgccgcgccttac
atcttcaccggcttgaggatcggcatcggcctgtcctggctcgccatcgtcgccgccgaa
atgctgactggcggcgtcggcatcggcttcttcatctgggatgcgtggaactcgtcgcgg
ctgcccgacatcatcgtcgcgctcgcctatatcggcgtcaccggcttctgcctcgaccgg
ctggtcgcggcggtcggcgccttcgtcacccgcggcacaacggcaaagtga

DBGET integrated database retrieval system