KEGG   Methylobacterium sp. 4-46: M446_2164Help
Entry
M446_2164         CDS       T00679                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00020  Citrate cycle (TCA cycle)
met00310  Lysine degradation
met00380  Tryptophan metabolism
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
met01130  Biosynthesis of antibiotics
met01200  Carbon metabolism
Module
met_M00009  Citrate cycle (TCA cycle, Krebs cycle)
met_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M446_2164
  Amino acid metabolism
   00310 Lysine degradation
    M446_2164
   00380 Tryptophan metabolism
    M446_2164
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     M446_2164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ACA16626
JGI: M4462164
UniProt: B0UCF3
LinkDB All DBs
Position
2411898..2414858
Genome map
AA seq 986 aa AA seqDB search
MARQDANETLLGTSFLYGANAAYIEDLYAAYTKDPNSVDPEWRSFFAGLKEEKAIVVKNA
EGASWTKPNWPVAANGELVSALDGNWSTLEKAVGDKIKSRAEAKGAPIAPADVQQATKDS
VRAIMLIRAYRMRGHLHAKLDPLGLQLRGDHEELHPQHYGFTDADYDRPIFLDNVLGLEF
STIREIVAILRRTYCQTLGVEFMHISDPEEKAWIQERIEGKDKEISFTEQGRRAILNKLI
EAEGFEKFLDLKYTGTKRFGLDGSEAMVPALEQIIKRGGALGVKEIVVGMAHRGRLNVLA
NVMSKPFRAIFHEFKGGSASPEEVEGSGDVKYHLGASSDRSFDGNGVHLSLTANPSHLEI
VDPVVLGKVRAKQDQHNDAPDQRTSVLPLLIHGDAAFAGQGVVAECLGLSGLKGHRTGGS
IHFIINNQIGFTTDPRFSRSSPYPSDVAKMVEAPIFHCNGDDPEAVVFAAKVATEYRQKF
HKPVVIDMLCYRRFGHNEGDEPAFTQPKMYKIIRKHPSTLEIYGKRLVEAGAVKEADLEA
RKSEFRSTLDSEFDVANAYKANKADWLDGRWSGLKSVREDEDDPRRGRTGVPAETLREIA
RQITKVPANFRLHRTIQRFLDNRAKAIETGEGLDWATAEALAYGSLLTEHHRVRLSGQDV
ERGTFSQRHSVLIDQETEERYTPLNHIREGQARYEVINSMLSEEAVLGFEYGYSLAEPNA
LVLWEAQFGDFANGAQVVIDQFISSGERKWLRMSGLVMLLPHGYEGQGPEHSSARLERYL
QLCAEDNMQVANCTTPSNYFHILRRQLKRDFRKPLVLMTPKSLLRHKRAVSRLDELTEGS
SFHRVLWDDAEKTPDGIRLVKDDKIRRVVLCSGKVYYDLFEEREKRGINDVYLMRVEQLY
PFPLKSLAGEVSRFRNAEVIWCQEEPKNMGAWTFVEPYLEWVLNQAGVASKRPRYVGRPA
SASTAVGLMSKHMAQLQAFLNEALAV
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atggcacgccaggacgcgaacgaaacccttctcggcacctcgttcctctacggggcgaac
gccgcctacatcgaggacctctacgcggcctacacgaaggatccgaactccgtcgatccg
gagtggcggagcttcttcgccggcctgaaggaggagaaggccatcgtcgtcaagaacgcc
gagggggcgtcctggacgaagccgaactggccggtcgccgccaacggcgagctggtctcg
gccctcgacggcaactggtcgaccctggagaaggcggtcggcgacaagatcaagtcccgc
gccgaggccaagggcgcgccgattgcaccggccgacgtgcagcaggcgaccaaggattcc
gtgcgcgcgatcatgctgatccgcgcctaccgcatgcgcggccacctgcacgccaagctc
gacccgctcggcctgcagctgcgcggcgaccacgaggagctgcacccgcagcattacggg
ttcacggacgccgattacgaccggccgatcttcctcgacaacgtgctgggcctcgaattc
tcgacgatccgcgagatcgtcgcgatcctgcggcgcacctactgccagacgctcggcgtc
gagttcatgcacatctccgaccccgaggagaaggcctggatccaggagcgcatcgagggc
aaggacaaggagatctccttcaccgagcagggcaggcgggccatcctcaacaagctcatc
gaggcggagggcttcgagaagttcctcgacctcaagtacacgggcaccaagcgcttcggc
ctcgacggctccgaggcgatggtcccggcgctggagcagatcatcaagcgcggcggcgcg
ctcggcgtgaaggagatcgtggtcggcatggcccatcgcggccggctgaacgtgctcgcc
aacgtgatgagcaagccgttccgggcgatcttccacgagttcaagggcggctcggcctcg
ccggaggaggtcgaggggtcgggcgacgtgaagtaccacctcggcgcgtcgagcgaccgc
agcttcgacggcaacggcgtccacctgtcgctcaccgccaacccgtcgcacctggagatc
gtcgatccggtcgtgctcggcaaggtccgcgccaagcaggaccagcacaacgacgcgccc
gaccagcgcacctcggtgctgccgctcctcatccacggcgacgccgccttcgcgggccag
ggcgtggtggcggagtgcctcggcctctcggggctgaagggccaccgcaccggcggctcg
atccacttcatcatcaacaaccagatcggcttcaccaccgatccgcgcttctcgcgctcc
tcgccctatccgtccgacgtcgccaagatggtcgaggcgccgatcttccactgcaacggc
gacgaccccgaggccgtggtcttcgccgccaaggtcgcgaccgagtaccggcagaagttc
cacaagccggtggtcatcgacatgctgtgctaccgccgcttcggccacaacgagggcgac
gagccggcgttcacgcagccgaagatgtacaagatcatccgcaagcacccctcgacgctg
gagatctacggcaagcggctggtcgaggccggggccgtcaaggaggcggacctcgaagcc
cgcaagtccgagttccggtcgacgctcgacagcgagttcgacgtcgccaacgcctacaag
gccaacaaggcggattggctcgacggccgctggtcgggcctgaagtcggtgcgcgaggac
gaggacgacccgcgccgcggccgcaccggcgtgccggccgagaccctgcgcgagatcgcc
cgccagatcaccaaggtcccggcgaatttccgcctccaccgcacgatccagcgcttcctc
gacaaccgcgccaaggcgatcgagaccggagaggggctcgactgggcgaccgccgaggcc
ctcgcctacggctcgctgctgaccgagcatcaccgggtccggctctccggccaggacgtg
gagcgcggcaccttctcgcagcgccactcggtgctgatcgaccaggagaccgaggagcgc
tacacgcccctcaaccacatccgcgaggggcaggcccgctacgaggtcatcaactcgatg
ctctcggaggaggcggtgctcggcttcgagtacggctactcgctcgccgagcccaacgcc
ctggtactgtgggaggcgcagttcggcgacttcgccaacggcgcgcaggtcgtgatcgac
cagttcatctccagcggcgagcgcaagtggctgcgcatgtcgggtctcgtgatgctgctg
ccgcacggctacgagggccaggggccggagcattcctcggcccggctggagcgctacctg
cagctctgcgccgaggacaacatgcaggtcgccaactgcacgacgccctcgaactacttc
cacatcctgcgccggcagctgaagcgcgacttccgcaagccgctcgtgctgatgaccccg
aagtcgctcctgcgccacaagcgcgcggtgtcgcggctcgacgaactcaccgaggggtcg
agcttccaccgggtgctctgggacgatgccgagaagacgccggacggcatcaggctcgtc
aaggacgacaagatccgtcgcgtcgtgctctgctcgggcaaggtctactacgacctgttc
gaggagcgcgagaagcggggcatcaacgacgtctacctgatgcgcgtcgagcagctctac
ccgttcccgctgaagtcgctggccggggaggtgtcgcgcttccgcaacgccgaggtgatc
tggtgtcaggaggagcccaagaacatgggcgcctggaccttcgtcgagccctatctcgag
tgggtcctcaaccaggcgggcgtggcctcgaagcggccgcgctacgtcgggcgcccggcc
tcggcctcgacggcggtcggcctgatgtcgaagcacatggctcagctccaggccttcctc
aacgaggccctggcggtctga

DBGET integrated database retrieval system