KEGG   Methylobacterium sp. 4-46: M446_3744Help
Entry
M446_3744         CDS       T00679                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
met  Methylobacterium sp. 4-46
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    M446_3744
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    M446_3744
Transporters [BR:met02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    M446_3744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4178160..4179026
Genome map
AA seq 288 aa AA seqDB search
MALGTSIGGLAAARRKGEASRGPLVTAAGLRALAARIVPPLVVLGLFLLVWQVLCDRPGA
GLPAPSRVMSEAWPIISDPFFDNGGTDKGLFWHIVASLQRVALGFALASVAGVLLGTLVG
QSEWAMRGLDPIFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWPIIINTAVGIR
NIPQDYRNVASVLRLNAFEFFGKIMLPSAAPYIFTGLRIGVGLSWLAIVAAEMLIGGVGI
GFFIWDAWNSSHISEIIVALVYVGVIGFVLDRVVAGIGQLVTRGTASA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggccctcggaacctccatcggcggcctcgccgccgcgcggcggaagggggaggcgtcg
cgcggccccctcgtcacggcggcgggcctgagggccctcgcggcccgcatcgtgccgccc
ctcgtggtgctcggcctgttcctgctcgtctggcaggtgctctgcgaccggcccggcgcc
ggcctgcccgccccgtcgcgggtgatgagcgaggcctggccgatcatctccgacccgttc
ttcgacaatggcggcaccgacaaggggctgttctggcacatcgtggcgagcctgcagcgc
gtggcgctcggcttcgcgctcgcctccgtggcgggcgtgctgctcggcacgctggtcggc
cagtccgaatgggccatgcgcggcctcgacccgatcttccaggtgctgcgcaccatcccg
cccctcgcctggctgccgctctcgctcgcggccttccgggatggccagccctcggccatc
ttcgtgatcttcatcacctcgatctggccgatcatcatcaacacggcggtcggaatccgc
aacatcccgcaggattaccgcaacgtcgcgtcggtgctccggctcaacgccttcgagttc
ttcggcaagatcatgctgccctcggcggcgccctacatcttcaccggtcttcgcatcggg
gtcggcctgtcgtggctggcgatcgtggcggccgagatgctgatcggcggcgtcggcatc
ggcttcttcatctgggacgcgtggaactcctcgcatatcagcgagatcatcgtcgccctc
gtctatgtcggcgtgatcggcttcgtcctcgaccgcgtggtcgccgggatcgggcaactc
gtcacccgcggcaccgccagcgcctga

DBGET integrated database retrieval system