KEGG   Methylobacterium sp. 4-46: M446_4569Help
Entry
M446_4569         CDS       T00679                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
met  Methylobacterium sp. 4-46
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M446_4569
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M446_4569
   00680 Methane metabolism
    M446_4569
Enzymes [BR:met01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M446_4569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
5023094..5025919
Genome map
AA seq 941 aa AA seqDB search
MYRPEETPDSPAAPESLEADLLQLVEQARQQASEDPFRNPVLTVALAISRRMDRGEVSEA
DLEPLFRSLRGQALEERAQRLRAYLGLDQEGGDDLARAVPLILGEESDFEVARARIERPR
FAAVFTAHPTFGMPKAVARLLAEAASTPAPEGRRALLGEAAGLSSRPDPVITLNDEFDQA
RFSVQHGRAALDGLNEALLRAARERWPEHWHDLVPQPVVIASWVGCDTDGRTDIGWWDTL
RYRLESKRTQFERVLAQLPEDPAAVPVRRLAEAARDAVSRQLAVAPKLGDDPSLEVVHRF
ALALIIERERAQTEAGPLLSALGAAIAATRDEEARLRLCVLRAGCAAHGLQNGLPHFRLN
ATQVHNAVRRSLDREGDPTDPAQRRSHLASINALLDHVEAVPVDFGALAAERSSASRLMM
TIAQILKHVDGTHPVRFLIAETETGYTLLAALWLAEHFGIGDKVEITPLFETASALEQGV
HVVEDALRSAHWRRYLRRIGRLVLQFGYSDSGRYVGQLAATFWIERLRLRITEMMVANGL
ADIELVIFDTHGESIGRGAHPASLRDRLAYLAPSQARLRNREAGLKVRLESSFQGTDGYL
LFGSAPLARATVLRIVEHVFEAGDPPPDPIYAEPDFATEFFTGARQDMETLVDDPGYAAL
LGTFGPNLIDRTGSRPVARQSDAGGPVAITHPRQIRAIPNNAILQQLGFLANSMHGVGHA
AARAPDLFGEMRAESERFRRAFSLVQHAARVSDLDVLRAYIETLDPGMWLERARRATRDG
RREEIIAIAGALDRLNLAPRLRRLFGRLTHDHLMLHSVARDLAAMSLRLTLLHALRLALI
HRIWFLAVHIPGFRPQAGVTRESLIERILRLDVPGCLKALDEIFPVTPDPTLGLNFGEPA
GPRGVGTYETEHRTLFEPIGRLFAQVREISGMIQHEVGAFG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgtaccggcccgaggaaacccccgactcgcccgccgctcccgagagcctggaggcggac
ctgctccagctggtggagcaggcccggcagcaggcgagcgaggacccattccgcaacccc
gtcctcaccgtggccctcgcgatcagccgccgcatggaccggggcgaggtgagcgaggcg
gacctcgaaccgctcttccgctccctgcgcgggcaggccctggaggagcgggcgcagcgc
ctgcgcgcctatctgggcctcgaccaggagggcggcgacgacctcgcccgcgcggtgccg
ctgatcctcggcgaggagagcgacttcgaggtggcccgggcccggatcgagcgaccgcgc
ttcgcggcggtcttcaccgcgcacccgaccttcggcatgcccaaggcggtggcccgcctg
ctcgccgaggccgcctcgacgccggccccggaaggccggcgggccctgctcggcgaggcg
gcggggctgtcctcccgccccgacccggtcatcaccctcaacgacgagttcgaccaggcc
cgcttctcggtgcagcacgggcgcgccgccctcgacgggctgaacgaggccctgctgcgg
gccgcccgcgagcgctggcccgagcactggcacgacctggtgccgcagccggtcgtgatc
gcctcctgggtcggctgcgacacggacgggcgcaccgatatcggctggtgggacacgctg
cgctaccggctggaatcgaagcgcacgcaattcgagcgggttctggcgcagctcccggag
gatccggccgccgtcccggtgcggcggctcgcggaggcggcccgcgacgcggtgtcgcgc
cagctcgccgtcgcccccaagctcggcgacgatccgagcctggaggtggtgcaccgcttc
gccctcgcgctgatcatcgagcgcgagcgcgcccagaccgaggcgggcccgctgctctcc
gccctcggcgcggcgatcgcggcgacgcgcgacgaggaggcgcggctcaggctctgcgtc
ctgcgcgccggctgcgccgcgcacgggctgcagaacgggctgccgcatttccggctcaac
gccacccaggtccacaacgcggtgcgccgctccctcgaccgggagggcgacccgaccgac
ccggcccagcgccgctcgcacctcgcctcgatcaacgcgctcctcgaccacgtcgaggcg
gtgccggtggatttcggcgcgctcgccgccgagcgctcctccgcctcccgcctgatgatg
acgatcgcccagatcctcaagcacgtggacggcacccatccggtgcgcttcctgatcgcc
gagaccgagaccggctacacgctcctcgccgcgctctggctcgccgagcatttcggcatc
ggcgacaaggtcgagatcacgccgctcttcgagaccgcctcggccctggagcagggcgtg
cacgtcgtcgaggacgcgctgcgctccgcccattggcggcgctacctgcgccggatcggc
cgcctcgtgctgcaattcggctactcggattccggccgctacgtcggccagctcgccgcc
accttctggatcgagcggttgcgcctgcgcatcaccgagatgatggtcgcgaacggcctc
gccgacatcgagctcgtgatcttcgacacgcacggcgagtcgatcggccgcggcgcccat
ccggcgagcctgcgcgaccgcctcgcctacctcgccccgagccaggcgcgcctgcgcaac
cgcgaggcggggctgaaggtgcggctcgaatcgagcttccagggcacggacggctacctg
ctgttcggctccgcgccgctcgcgcgcgccaccgtgctgcgcatcgtcgagcacgtcttc
gaggcgggcgatcccccgcccgatccgatctacgccgagcccgacttcgccaccgagttc
ttcaccggcgcccggcaggacatggagacgctggtcgacgatcccggctacgcggccctg
ctcggcaccttcgggccgaacctgatcgaccgcaccgggtcgcggccggtggcgcgccag
tccgacgcgggcggcccggtcgcgatcacccatccacggcagatccgggcgatccccaac
aacgccatcctgcagcagctcggcttcctggcgaattcgatgcacggggtcggccacgcc
gccgcccgggccccggacctgttcggcgagatgcgggcggagtccgagcgcttccggcgc
gccttcagcctcgtccagcacgccgcccgggtcagcgacctcgacgtgctgcgcgcctac
atcgagacgctcgatcccggcatgtggctggaacgggcgcggcgggcgacgcgcgacggg
cggcgggaggagatcatcgccatcgcgggtgccctcgaccggctgaacctcgccccgcgc
ctgcgccggctgttcgggcgcctgacccacgaccacctgatgctgcactcggtggcgcgc
gacctcgccgcgatgagcctgcggctgaccctgctgcacgcgctccggctcgcgctgatc
catcggatctggttcctggccgtgcacatcccgggcttccggccgcaggccggcgtcacc
cgcgagagcctgatcgagcgcatcctgcggctcgacgtgccgggctgcctgaaggcgctg
gacgagatcttcccggtgacgccggacccgacgctcggcctgaatttcggcgagccggcc
gggccgcgcggggtcggcacctacgagacggagcaccggaccctgttcgagccgatcggc
cgcctcttcgcgcaggtgcgcgagatcagcggcatgatccagcacgaggtcggggccttc
ggctga

DBGET integrated database retrieval system