KEGG   Methylobacterium sp. AMS5: Y590_23210Help
Entry
Y590_23210        CDS       T04283                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
meta  Methylobacterium sp. AMS5
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:meta00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y590_23210
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Y590_23210
   00680 Methane metabolism
    Y590_23210
Enzymes [BR:meta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Y590_23210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5038838..5041801)
Genome map
AA seq 987 aa AA seqDB search
MPLEDPRSGPPQSSMPNASMPTSGHPTAASARPTDRDLEAELLDLVARTREQASEDPFRN
PVLAVTLAITRRLDRDEIGESDLDALLATLRRRALTDRAERLRAYVGLDTDAATGEAAPA
VEVANRLVAAVARGSGDFDAFRERVGRTAFAAVFTAHPTFGMPRAVAELIARAASLADAD
RRAPIIGEAAARSTRPDPQISLDDEFEQACVAANHGRAAIDAFNGAILDAARARWPDRWT
ELVPKPLAIASWVGCDTDGRTDIGWWDTMRYRLISKRMQFDRLMRDLPDVPATRVVRELT
AGARDAVERQLAGAPLLGTKPSLEAVHRFALALIIERERAQTDAGPILAGLAAAIGAAET
DADRRAIAVLRSGIAAHGLSNALPHFRLNASQIHNAVRRVIDLEGEPTDAAQRRSHLSAI
NTLLNDVRPVPVDFGALAAERASAARLMMTITQILKHVDGTHPVRFLIAETETGYTLLSA
LWLARHYGISDKLEITPLFETASALEQGIRVLDDALRNPHWRNHLKRLGRLSVQFGYSDS
GRYVGQLAATFWIERLRLRITELMTQNGLSDIELVIFDTHGESIGRGAHPTSLRDRLAYL
APEDSRQRNAKAGMRERLESSFQGSDGYLMFGSPELAGASVARIAEHVFADALTEDDAFA
DYALNDRAAAPTTDPIYEEADFAAEFFRVVRQDMETLVDDRGYAALLGTFGPSLIDRTGS
RPVARQSDGGGPAAITHPRQMRAIPNNAILQQLGYLANSLHGVGRAAHRAPELFRHMRTN
SVRFSRAFRLVQHAASVGDLDVMRAYIDTLDPAVWLERARRTRRDARRDELVTIAAALER
LNLSPDLRRLFGRLTRDGLLLQAAAPDLAAMSTRLALLHAIRLALIHRIWFLAAHIPSFR
PQAGLTREALLERFLRLDIDGCLKLLDEIYPVTPDPTLGLNFGEPPGPRDVGTYETEHNT
LFGPIRRMFERVREISGIIQHEVGAFG
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcgaagacccccgctccggcccgccgcaatcctcgatgccgaacgcctcgatg
ccgacatccgggcacccgaccgccgcgtccgcacggcccacggatcgcgatttggaagcc
gagcttctcgacctcgtcgcccgcacccgcgagcaggcgagcgaggacccgttccgcaac
cccgttctcgccgtcacgctcgccatcacccgccggctcgaccgggacgagatcggggaa
tcggatctcgacgccctgctcgccaccctgcggcggcgggcgctgacagacagggctgag
cggctgcgcgcctatgtcggcctcgacaccgacgccgccacgggggaggcggcgcccgcg
gtggaggtcgcgaaccggctcgtggcggcggtggcgcggggctcgggcgatttcgacgcg
ttccgcgagcgcgtcggccgcaccgcttttgcggcggtgttcacggcgcaccccaccttc
ggcatgccgcgggccgtggccgagttgatcgcgcgggccgcctcgctcgccgatgccgac
cggcgcgcgccgatcatcggcgaagccgccgcccgctcgacccggcccgatccgcagatc
agcctcgacgacgaattcgagcaggcctgcgtcgccgccaaccacggccgtgcggcgatc
gacgccttcaacggcgcgatcctcgatgccgcccgcgcccgctggccggatcgttggacc
gagctggtgcccaagccgctggccatcgcgagctgggtcggctgcgacaccgacggtcgc
accgatatcggctggtgggacacgatgcgctaccggctgatttccaagcgcatgcagttc
gaccggctgatgcgcgacctgccggacgtgccggccacccgcgtggtgcgcgagctgacc
gcgggcgcgcgggacgccgtcgagcgtcagctcgcgggcgcgccgctgctcggcaccaag
ccctcgctggaagcggtccaccgcttcgcgctggccctcatcatcgagcgcgagcgcgcg
cagaccgatgccgggccgatcctggccgggctggccgcggcgatcggcgccgccgagacc
gatgcggaccgccgcgccatcgccgtgctgcgctcaggcattgccgcccacggcctctcg
aacgccctgccgcatttccggctcaacgccagccagatccacaacgcggtgcgccgggtc
atcgatctcgagggcgagccgaccgacgcggcgcagcgccgctcgcacctctcggcgatc
aacacgctgctcaacgacgtgcgccccgtgcccgtcgatttcggagcgctcgccgccgag
cgcgcctcggccgcgcggctgatgatgacgatcacccagatcctcaagcatgtcgacggc
acgcacccggtgcgcttcctcatcgccgagaccgagaccggctacaccctgctctccgcg
ctctggctcgcgcgccattacggcatctcggacaagctcgagatcacgccgctgttcgag
accgcgagcgcgctcgaacagggcatccgcgtcctcgacgacgccctgcgcaacccgcac
tggcgcaaccacctcaagcgcctcggccggctctcggtccagttcggctactcggattcc
gggcgctatgtcggccagttggcggccaccttctggatcgagcggctgcgcctgcgcatc
accgagctgatgacgcagaacgggctctccgacatcgaactcgtcatcttcgacacccac
ggcgaatcgatcggccggggtgcccacccaacgagcctccgcgaccgcctcgcctatctc
gcgccggaggattcgcgccagcgcaacgcgaaggcgggcatgcgcgagcggctcgaatcg
agcttccagggctcggacggctacctgatgttcggttcgcccgaactggcgggcgcctcg
gtggcgcgcatcgccgagcacgtcttcgccgacgcgctgaccgaggacgacgccttcgcc
gattacgcgctcaacgaccgggccgccgcacccaccacggacccgatctacgaagaggcc
gacttcgccgccgagttcttccgcgttgtccgccaggacatggaaaccctggtcgatgat
cgcggctacgccgcccttctcggcaccttcggcccgagtctgatcgaccgcaccggctcg
cgccccgttgcgcgccagtcggatggcgggggcccggccgcgatcacccatccgcggcag
atgcgggcgatccccaacaacgcgatcctgcagcagctcggctatctcgcgaactcgctg
cacggcgtcggccgcgccgcgcaccgggcgccggagctgttccggcatatgcggacgaac
tcggtgcgcttctcccgcgccttccgcctcgtgcagcacgccgccagcgtcggcgacctc
gacgtcatgcgcgcctatatcgacacgctcgatccggccgtgtggctggagcgggcccgg
cgcacccggcgcgacgcgcggcgcgacgagctcgtcaccatcgccgccgcgctggagcgg
ctgaacctctcgcccgacctgcgccgcctgttcggtcgtctcacccgcgacgggcttctg
ctccaggccgcggcgccggatctggcggcgatgtcgacccggctggccctgctccacgcg
atccgtctcgcgctgatccaccggatctggttcctggccgcccacattccgagcttccgc
ccgcaggcgggcctgacccgcgaggcgctgctggagcgcttcctgcgcctcgacatcgac
ggctgcctgaagctgctcgacgagatctaccccgtgacccccgacccgacgctcggcctg
aacttcggcgagccgccgggcccgcgcgacgtcggcacctacgagaccgagcacaacacg
ctgttcggcccgatccggcggatgttcgagcgggtgcgggagatctcggggatcatccag
cacgaggtcggcgcgttcggctga

DBGET integrated database retrieval system