KEGG   Methanothermobacter sp. CaT2: MTCT_0857Help
Entry
MTCT_0857         CDS       T04009                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
metc  Methanothermobacter sp. CaT2
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:metc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTCT_0857
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTCT_0857
   00680 Methane metabolism
    MTCT_0857
Enzymes [BR:metc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MTCT_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
844010..845443
Genome map
AA seq 477 aa AA seqDB search
MSTQHPDNVNPPFFAEEPELGGEDEIREAYYVFSHLGCDEQMWDCEGKEVDNYVVKKLLT
KYQAFFRDHVLGEDLRLTLRVPNPTVERAEAKILLETLESIPRSYDTASLFYGMDAAPVF
EVILPMTSSSSCLNRIHSYYLDFVKGKERLQLADGVTVKEWIGEFRPDEINVIPLFEDHE
GMLNAAKITGEYLDGKDIQEQRVFLARSDPAMNYGMISATLLNRIALSDFRDLEEESGVK
LYPIIGMGSAPFRGNLRPDNVEDVTWEYRGAYTFTVQSSFKYDHEPSDVIRGIKKLRSVK
PGRAAEIERESVLEIISAYCREYRRQVMDLVDIINRVARYVPGRRKRKLHIGLFGYSRSM
GNVSLPRAITFTAALYSLGVPPELLGFNALSSGDLEFIEEVYPGLGRDLHDAARYANPES
PFLSPEVKSSFEEYLEPEYDEGHMKTTEEIIRALRINRTANLQELILEAASQRKFLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacagcatccagacaacgttaacccgccgttctttgcagaagaacctgaactg
ggtggtgaagacgagataagggaggcatactacgtcttctcacacctgggatgtgacgaa
cagatgtgggactgcgagggcaaggaagtggacaactacgttgtaaagaaactcctcaca
aagtaccaggccttcttcagggaccatgtcctgggtgaggatctgaggctcaccctcagg
gtgcccaaccccacagttgagagggccgaggcaaagatactccttgagacccttgagagc
atacccagatcctatgacaccgcaagcctcttctacgggatggacgcagccccggtcttc
gaggtcatcctacccatgacctcatcaagcagctgcctcaaccggatccacagctactac
ctggactttgtgaagggtaaggagaggctgcagctcgcagatggtgtgaccgtcaaggag
tggataggtgaattccggcccgacgagatcaacgttatccccctcttcgaggaccatgag
gggatgctgaacgccgccaagatcacaggcgagtaccttgatggtaaggatatccaggag
cagagggtcttccttgcaaggtcagaccccgccatgaactacggtatgatatcagccaca
ctcctcaacaggatagccctctcagacttccgggaccttgaggaagagtcaggagttaaa
ctctaccccataataggtatgggctcagctcccttcaggggtaacctccgccccgataat
gtggaggacgttacctgggagtaccgtggcgcctacaccttcactgtccagtcatccttc
aagtacgaccatgaaccatcagatgtcatcaggggcataaagaaactcaggtctgttaaa
ccgggcagggcagctgaaatcgagcgtgaaagtgtcctggagataatttcagcctactgc
agggagtacaggaggcaggtcatggacctcgtggacatcataaacagggttgcgaggtac
gtgcccggcaggaggaagaggaagctccacatcggactcttcggatactccaggagcatg
ggaaacgtttcactcccaagggcaataaccttcacagcggccctctactcgctgggggtt
cccccggagctgctcgggttcaacgcgctatcatcaggtgaccttgaattcattgaggag
gtctacccgggtcttggaagggacctccatgacgctgcaaggtacgccaaccctgaatca
ccattcctcagccctgaggttaaatcatcctttgaggagtaccttgaacctgagtatgat
gagggacacatgaagaccacagaggagatcataagggccctcagaatcaacaggacagcc
aacctccaggagctcatccttgaggctgcaagccagaggaagttcctcggctga

DBGET integrated database retrieval system