KEGG   Methanothermobacter sp. EMTCatA1: tca_01178Help
Entry
tca_01178         CDS       T05328                                 

Definition
(GenBank) hypothetical protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mete  Methanothermobacter sp. EMTCatA1
Brite
Enzymes [BR:mete01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     tca_01178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M T2SSE_N
Motif
Other DBs
NCBI-ProteinID: BAZ99237
UniProt: A0A223YYE9
LinkDB All DBs
Position
complement(1097007..1098143)
Genome map
AA seq 378 aa AA seqDB search
MNSDIPFDLIQERTGVPSSRLKVAFARGSLRLLESAGLQALLFKKPLGDLEAGTVIYLGD
ETEVIRGFPKIRRTLLLSPTIQEHFRDRVAVEEKMNGYNVRIACLSSGETVALTRGGHVC
PFTTRKAQELLDLSEFFREHPDLVICGEMIGRDNPYVSQDYPEVGPLGFRVFDLREKNTN
RPLPVEERRALLDSYGLPNVRLFGVYPIEEAASEVADIIRALGMAGREGVVMKDPSMEVP
PLKYTSSQAHARELAYAFSYPFDFGRPFFFSRVIREGFQAYELDESDDETRERARRLGEA
IIYPMLERIKSISAGEAAYEDTVIDVEDREAAEEFIRHLVRLGVSATLADYRDGRATIRR
FYQSTTDRINNYLKGGLY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgacatccccttcgatctgatccaggaaaggacaggagtaccatcctccagg
ttaaaggttgcatttgcccgggggagcctgaggctacttgaatctgcgggtctgcaggcc
ctcctcttcaagaagcccctgggggacctggaggcagggacggtgatctaccttggagat
gaaactgaggtcataaggggatttccaaagataaggaggacactgctactctcacccacc
atccaggaacacttcagggacagggttgctgtagaggaaaagatgaacggctacaatgtc
cgtatagcatgcctatcatcgggagaaaccgttgcactcacaagggggggccatgtctgc
ccattcaccacccgaaaggcccaggagctccttgacctctctgaattcttcagggaacac
ccggaccttgttatatgtggagagatgattggaagggacaacccctatgtttcacaggac
taccctgaggtcggacccctcggattcagggtattcgatctgagggagaagaacacgaac
agacccctccctgttgaagagaggagggcgctcctggattcctatggacttcctaatgtg
cgcctctttggggtctaccccattgaggaggccgccagtgaggtcgcggatataataagg
gccctgggaatggctggaagggagggtgtggttatgaaggaccccagcatggaggtgcct
cccctcaagtacacctcatcacaggcccatgcacgtgaactcgcatacgccttcagctac
cccttcgacttcggaagacccttcttcttcagcagagtcataagggagggcttccaggcc
tatgaactcgatgaatcggatgatgaaacccgtgaaagggcacgccgcctcggggaggca
ataatataccccatgcttgagagaataaagagcatatcagctggtgaggccgcctatgag
gacacggtcatcgacgttgaggaccgggaggcggcagaggaattcatacgtcaccttgtc
cgtctgggggtctcagccacccttgcagattaccgtgacggcagggcaaccataaggcga
ttctatcagtcaacaacagacaggataaacaactaccttaaggggggtctctactga

DBGET integrated database retrieval system