KEGG   Methanosarcina sp. MTP4: MSMTP_0489Help
Entry
MSMTP_0489        CDS       T03850                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
metm  Methanosarcina sp. MTP4
Pathway
metm00500  Starch and sucrose metabolism
metm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MSMTP_0489
Enzymes [BR:metm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MSMTP_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 Gcw_chp
Motif
Other DBs
NCBI-ProteinID: AKB23958
UniProt: A0A0E3L0L9
LinkDB All DBs
Position
complement(584750..585946)
Genome map
AA seq 398 aa AA seqDB search
MTSLCLYFQIHQPFRLRWFWPDDRTGFFRYFDERGDREIFKRVAEKCYLPANRILLEALD
EHRGEFKFALSVTGTHLEQCELWEEDVLEDFRQMAKTGAVEFLDETCYHSISSLFEDKTE
FIEEIREHRRLMKDLLGVKPEVFRNTELLYNNTIGKIALDLGYKAVLTEGADHMLGWRSP
NFVYEATGSGIPILVRNYKLSDDIGYRFSARWWDGYPLTAEKWAQWASGIREDCINIFMD
YETFGEHQWEETGIFAFLRNLPEKVLETRLTFDTPSEVVKKYTPVAEIDVGDFSTISWAD
MERDTSAWLGNDMQRRCFEEIKLLEPFVKKTGDPELLNIWKHLLTSDHYYYMCTKWLGDG
DVHSYFSVHPTPYDAGVNFMAALMDFKARVFRKLSTIA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacctccctttgcctttatttccagatacaccagccatttcgcttgcgctggttctgg
cccgatgacaggacaggttttttccgctatttcgatgaaaggggagaccgcgagattttc
aagagagtggcagaaaaatgctacctgcctgccaacaggatccttctggaggccctggac
gagcacaggggagaattcaaattcgccctttcggtgacaggaacccatctggagcagtgc
gaactctgggaggaagatgtgcttgaagacttcaggcagatggcgaaaaccggagctgtg
gagttcctggacgagacctgctaccattcaatctcaagcctttttgaggacaaaacggaa
tttattgaagagataagggaacaccgcaggctcatgaaagaccttctcggagtaaaaccc
gaagtgttccggaatacagagctactttacaataacacgatagggaaaattgccttggat
ctcggatacaaagcagtccttacggaaggtgcggatcacatgctcggctggaggtccccg
aactttgtgtacgaagcaacgggatcgggaataccgatactcgtcaggaactacaagctg
agcgacgatatagggtaccgtttttcggcccgctggtgggacggctaccccctgactgcg
gaaaaatgggctcaatgggcttccggaatcagggaagattgcatcaacatttttatggac
tatgagactttcggggagcaccagtgggaagaaacaggcatctttgcgtttctgagaaat
ctcccggagaaagtcttagagactcgtttgactttcgacaccccctcggaagttgtgaaa
aaatatactccggtagcggaaatcgatgtaggggacttttccaccatttcctgggcggac
atggaacgcgacaccagcgcctggttgggaaacgatatgcaaagacgttgttttgaagag
attaaactccttgaaccttttgtgaaaaaaaccggggacccggaactcctgaacatctgg
aaacacctgctgacctcggaccactactactacatgtgcacaaaatggctcggggacggg
gatgttcattcttacttcagcgtacacccgaccccctatgatgccggcgtgaatttcatg
gccgcattgatggacttcaaggccagggtgttcagaaaactcagcacaatagcttaa

DBGET integrated database retrieval system