KEGG   Methanobacterium sp. MZ-A1: BK008_03650Help
Entry
BK008_03650       CDS       T05317                                 

Definition
(GenBank) RNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
metn  Methanobacterium sp. MZ-A1
Brite
Enzymes [BR:metn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BK008_03650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AUB57494
UniProt: A0A2H4VHC9
LinkDB All DBs
Position
complement(746139..747287)
Genome map
AA seq 382 aa AA seqDB search
MREKNTPPLVTDEEVSHLLDIPSPRLEDAYRKGIIKKYQKHDLDAIQFRKGLGRMEAGTM
VIKGEDMEVIRGFPKIRRTLMLHPALEKHFPREVAVEEKMNGYNVRIAQVNGRIVAFTRG
GYICPYTSRKATQILDLDEFFQNYPEMVICGEMVGTLNPYVSHYYPEVGKLGFRIFDLRE
KLTNKPLPVLDKRELLADYHLEPVRLLGIFPVKEAPENIMEITNELGKNDREGVVMKDPQ
MELEPLKYTSSQAQAAELEYALSFPFDLAQAFLFSRIIREGFQAHEAGETGEKLRERALR
MGESALYPMLQTISKVEQGELAAEDLLIEVDNLEEAEEFIRHLRDLKVMATLVEVKNGKA
VIRRIHQSTNDRINNYLDGGLY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaaaaacaccccacccctggtaactgatgaggaagtttcccatctcctggac
ataccctcccctagactggaggatgcctaccggaagggtatcataaaaaaataccagaag
cacgacctggatgccatacagttccggaaaggattgggaaggatggaagcagggaccatg
gtgataaaaggggaggatatggaagttataaggggtttccccaagataagaagaactctg
atgctccacccggccctggaaaaacatttcccccgggaagtggcagtggaggagaagatg
aacggatacaacgtccgtatagcccaggttaacgggaggatagtggccttcaccaggggt
ggttacatctgcccctacaccagccgtaaagccacccagatacttgatctggatgaattc
ttccagaactacccagagatggtcatctgtggtgagatggtgggcacccttaacccctac
gtatcccactactacccggaggtggggaaactgggattccgcatattcgacctccgggag
aaactcaccaacaaacccctcccagtcctggacaaaagggaactcctggcagactaccac
ttggaaccagtacgactactgggaatattccctgtgaaagaggctccggagaatatcatg
gagatcaccaatgaattggggaaaaacgaccgggagggagtggtgatgaaggatccccag
atggaactggaacccctgaagtacacctcatcccaggcccaggccgcagaactggaatat
gcactgagcttcccctttgacctggcccaggcattcctcttcagcaggatcattcgagaa
ggattccaggcccatgaagccggagaaacaggagaaaaactacgcgaaagagcattgagg
atgggggagtcagcactatatcccatgctgcaaaccattagcaaggtggagcagggtgaa
ctggcagcagaggacctgttaatagaagtagataacctggaagaagccgaggaatttatc
cgccacctcagggatttgaaggtcatggccaccctggtcgaggtaaaaaatggtaaagca
gtgataaggagaatacaccaatccaccaatgaccgtataaacaactaccttgatggggga
ttgtattaa

DBGET integrated database retrieval system