KEGG   Methanobacterium paludis: MSWAN_2130Help
Entry
MSWAN_2130        CDS       T01509                                 

Definition
(GenBank) Y414 protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mew  Methanobacterium paludis
Brite
Enzymes [BR:mew01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MSWAN_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AEG19138
JGI: MSWAN_2130
UniProt: F6D3G2
LinkDB All DBs
Position
complement(2226929..2228143)
Genome map
AA seq 404 aa AA seqDB search
MDVTIGRTNSHKNFFFKCRSCNFSYDHTLPSFVKTELSKIVGLESHQLERSFQRGNIKFY
DSQGVNALQFRKRIHNIESGTMICFGDEIEVIRGFPKIRRTLMLSPTLKDHFTDEVAVEE
KMNGYNVRIALVNGRIIAFTRGGYICPYTTRKAPEIMDMTDFFKDHPELVICGEMVGTEN
PYVTHYYKEIGSLGFRIFDLREKVTNQPMSLHDKRGMLEKYGLPSVRLFGIYGVDEAVFE
VGGIIKNLEQTNREGVVMKDPQMQIPPLKYTSSHAHADELKYAFTYPFDFGRPFFFSRVI
REGFQAYELDESGEDLKKRAQRLGEAILYPMLNTIKHVSKEKVAGEDLVIHVDSYEEAAE
FVHHLQDLGVVATVHNFEDGKAVIRRIHQSTTDRITNYLRGGLY
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaacgattgggagaacaaactcccataaaaactttttttttaaatgtcgatca
tgcaactttagctacgaccataccttaccttccttcgtaaaaaccgaactctcaaaaatt
gttggtttagagtcccatcagctggaaaggtcgtttcaaaggggaaatataaaattctac
gattctcaaggtgtgaatgcccttcaatttcgaaaaaggatacacaatatagaatccgga
accatgatatgttttggagatgaaattgaggttataagagggtttccaaagataagaagg
actctgatgttatcccctaccttgaaggatcattttacggatgaagtggccgttgaagaa
aagatgaacgggtacaacgtcagaatagcccttgtaaacggtagaataattgcatttacc
agaggagggtacatatgtccatacaccactcgaaaagcacctgaaatcatggatatgact
gattttttcaaggatcatcctgaactggtaatatgtggtgagatggttggaacagaaaat
ccctatgtaacacattactacaaagagattggcagtctggggtttaggatatttgatctc
agggagaaggtaacaaaccaaccaatgtccctgcatgacaagagggggatgcttgaaaaa
tatggtctgccatctgtaagactctttggaatttatggtgttgatgaagccgtttttgag
gtggggggtatcataaaaaaccttgaacaaacaaacagagagggcgtggttatgaaggac
ccccagatgcagatacctcctttgaagtacacatcatcacatgcacatgcagacgagctt
aaatatgcattcacatatccatttgactttggaaggccatttttcttcagcagagtgata
agggaaggttttcaagcctatgaactggacgaatccggagaggatcttaaaaagagggct
cagagacttggtgaagccattttgtacccaatgcttaatacaataaaacatgtttctaag
gagaaggtggcaggggaggatctggtcattcacgttgatagttacgaggaggctgcagag
tttgttcaccaccttcaggaccttggagtggttgcaaccgttcacaacttcgaggatggg
aaagcagttataaggagaatacatcaatctacaactgacaggataacaaattatcttagg
ggtggcctatactga

DBGET integrated database retrieval system