KEGG   Mycoplasma fermentans JER: MFE_01660Help
Entry
MFE_01660         CDS       T01325                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
mfr  Mycoplasma fermentans JER
Pathway
mfr00010  Glycolysis / Gluconeogenesis
mfr00230  Purine metabolism
mfr00620  Pyruvate metabolism
mfr01100  Metabolic pathways
mfr01110  Biosynthesis of secondary metabolites
mfr01120  Microbial metabolism in diverse environments
mfr01130  Biosynthesis of antibiotics
mfr01200  Carbon metabolism
mfr01230  Biosynthesis of amino acids
Module
mfr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mfr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MFE_01660 (pyk)
   00620 Pyruvate metabolism
    MFE_01660 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    MFE_01660 (pyk)
Enzymes [BR:mfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     MFE_01660 (pyk)
Membrane trafficking [BR:mfr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MFE_01660 (pyk)
Exosome [BR:mfr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MFE_01660 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADN68781
LinkDB All DBs
Position
complement(164325..165758)
Genome map
AA seq 477 aa AA seqDB search
MNITDKRSKLVITVGPSSDNYKMLRSLIEAGATCVRANFSHGDHAEQLNKFVLAQKISKD
LHLPISLMLDTKGPEIRLGKMKDGKQEIPANKEIKVWTTKEKYETVEGTEKELTVAYDMA
QDLVVGNQVLFDDGKLSTIVTKVDRKAGYVVVKTLNKHLLKTNKRINLPGVDFSLPFLAQ
KDIDDVKFGIKNGINYVAASFVNSSKNVQELRKLLDDNGGKHVKIISKIESHLGTKNIDE
IIQASDGVMVARGDLGLEIPYYDVPYFEKIMIRKCREAGKPVVVATQMLDSMENSPQPTR
AEVTDVYYATEMGADSTMLSGESASGNYPLEAVTVMSKINKRAESEFYDKNYYDVQLEEI
RKNSSNSKRSRIAYDVANRTRYGDYRFAVVLSRTGQLLSEVAKFRPNTLIVGILNDENLI
GGFGVTSSVWVSLDSIELFAKIKKDKSKALNALKPYGVKKGDRFLVVENESITEFVA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaacattactgacaaaagaagtaagttagttattacagttggtccatcaagtgataac
tacaaaatgcttcgttcattaattgaagcaggtgcaacctgtgttcgtgctaactttagc
cacggagaccatgcagaacaattaaacaaatttgttcttgcacaaaaaatttctaaagat
ttacatcttcctatatctcttatgttagatactaagggtccggaaattcgtttaggaaaa
atgaaagatggaaaacaagaaattccagcaaacaaagaaattaaagtttgaacaactaaa
gaaaaatatgaaaccgtagaaggaacagaaaaagagttaactgttgcttatgacatggct
caagacttagttgttggaaaccaagttctctttgacgatggtaaattatcaacaattgta
actaaagttgatagaaaagctggttatgttgttgttaaaacacttaacaagcacttatta
aaaactaacaaacgtattaatttaccaggtgttgacttttctcttccatttttagctcaa
aaagacattgatgatgttaaatttggtattaaaaacggaattaactatgtagcagcatca
tttgttaactcatctaaaaatgtccaagaattacgtaaattattagatgacaatggtgga
aaacacgttaaaatcatttctaaaattgaaagccacttaggaaccaaaaacattgatgaa
atcattcaagcatcagatggtgttatggttgctcgtggggacttaggtcttgaaattcct
tactatgatgttccttattttgaaaaaataatgatcagaaaatgtcgtgaagcgggtaaa
ccagttgttgttgcaactcaaatgttagactcaatggaaaactcaccacaacctacacgt
gctgaagttactgacgtttactatgcaacagaaatgggtgctgactcaacaatgctttca
ggtgaaagtgcatcaggcaactatcctttagaagcagttacagttatgtcaaaaattaac
aaacgtgctgaaagtgaattttatgacaaaaattactatgatgttcaattagaagaaatt
agaaaaaattcttcaaattcaaaacgttcaagaattgcttatgacgttgcaaacagaaca
cgttatggtgactatagatttgctgttgttctttcaagaacaggtcaattattaagtgaa
gttgctaaatttagaccaaatacattaatcgttggtattttaaatgatgaaaacctaatc
ggtggatttggtgttacttctagtgtttgagtatcattagattcaatcgaattatttgca
aaaatcaaaaaagataaaagcaaagctcttaatgctcttaaaccatatggtgttaaaaaa
ggcgaccgctttttagtagttgaaaacgaaagtattactgaatttgttgcttaa

DBGET integrated database retrieval system