KEGG   Mycobacterium fortuitum: XA26_57090Help
Entry
XA26_57090        CDS       T04105                                 

Definition
(GenBank) Catalase
Organism
mft  Mycobacterium fortuitum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5853613..5855391
Genome map
AA seq 592 aa AA seqDB search
MPKPSLLMRLFLTTTELIDRRIGWDKLPPVLGVAVLVGIRDALREHNLYDTCQGAPPEAD
PLPPSDYLTVRTANGSYNDLSAPSMGMANTRFGRNVPLTEGRSEQLPELMDPNPRLISTK
LLQRRAFRPATTLNVLAAAWLQFETRDWFSHGSDPNRMLEIPRPPEDDWPEDTIKVPATA
VDPTAEPGGSTFLNTETHWWDGSQIYGSNQQFQDAIRTHHDGKVCIDADGFIDIPPTLIG
AAGGADGWWLGMELMGTIFMREHNAICDRLKAAYPNWNDDQLFNKARLINAALIAKIHTI
EWTPAILGHPTLQIGMRANWFGLAGERVKELFGRLSAGDLLSGIPGSNTDHHTAPYSITE
DFVTVYRMHPLVPDDYEFLSLTSGIEPRALTFRDIHGGANSRGVLKSQGVAECLYSLGVA
HPGAVTLHNSPTFMRDFERVDEHALDMIATDILRSRERGVPRYNDFRRALRLAPATSFDE
ISGGDAATAAVMAEIYGGDIEKVDTMVGMFGEKLPEGFGFSDTAFRIFVLMASRRLKSDR
FYTVDFTPRVYTPEGMDWIDRNDMVSVLLRHYPELEPALRGQRNAFAPWTRL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagccctcacttctcatgaggctgttcctcacgaccactgaactgatcgaccgg
cggatcggctgggacaagctgccgccggtgctcggcgtcgcggtgctggtcggtatccgc
gacgccctgcgtgagcacaacctgtacgacacctgccagggagcgccgcccgaggccgac
ccgctgcctccgtcggattacctgacggtgcggacggccaacggttcctacaacgacctg
tcggctccgtcgatgggcatggcgaacacccggttcgggcgcaatgtgccgctcaccgag
ggtcgctccgagcaactgccggagctgatggaccccaatcctcgactgatcagcaccaag
ttgttgcagcgccgggcgttccggccggccaccacgctcaacgtgctggccgcggcgtgg
ctgcaattcgagacccgcgactggttcagtcacggctccgaccccaaccggatgctcgag
atcccgcggccacccgaggacgactggcccgaggacaccatcaaggtccccgccacggcc
gtcgaccccaccgcggagcccggcggttcgacctttctgaacaccgagacccactggtgg
gatggctcgcagatctacggcagcaatcaacagttccaggacgcgatccgcacccaccac
gacggcaaggtgtgcatcgacgccgacggtttcatcgacatcccgcccacgctgatcggc
gccgccggaggcgcggacggctggtggctgggcatggagctgatgggcaccatcttcatg
cgcgagcacaacgcgatctgcgaccggctcaaagcggcctacccgaactggaacgacgat
cagctgttcaacaaggcgcgcctgatcaacgccgcgctgatcgccaagatccacaccatc
gaatggaccccggcgatcctggggcatccgaccctgcagatcgggatgcgggccaattgg
ttcggcctggccggtgagcgggtcaaggagttgttcggacggctgagcgcaggcgatctg
ctcagcggcatcccgggctcgaacaccgaccaccacaccgcgccgtactcgatcaccgag
gacttcgtcaccgtctaccggatgcacccgctggtgcccgacgactatgaattcctcagc
ctcacaagcggtatcgagccgcgcgcgctgacgttccgcgacatccacggcggggcgaac
tcccgcggtgtgctcaagagccagggcgtcgccgaatgcctctactcactgggtgtcgcc
catcccggtgccgtcaccctgcacaacagcccgaccttcatgcgggacttcgagcgggtc
gacgagcacgcactggacatgatcgccaccgacatcctgcgctcccgcgaacgaggtgtg
ccgcgctacaacgacttccgccgcgcactccggctcgccccggcgacgagcttcgacgag
atcagcggcggcgacgcggcgactgccgccgtgatggccgagatctacggcggcgacatc
gagaaggtcgacaccatggtcggcatgttcggggagaagctgccggagggattcgggttc
agcgacaccgcattccggatcttcgtgctgatggcgagccggcgcctcaagagcgaccgg
ttctacaccgtggacttcaccccgcgggtctacacgcctgaaggcatggactggatcgac
cgcaacgacatggtctcggtgctgctgcgtcactaccccgagctggagccggcgctgcgc
gggcaacgcaacgcgttcgcgccgtggacgcgcctgtag

DBGET integrated database retrieval system