KEGG   Mycoplasma gallisepticum NC08_2008.031-4-3P: HFMG08NCA_4952Help
Entry
HFMG08NCA_4952    CDS       T02327                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mgan  Mycoplasma gallisepticum NC08_2008.031-4-3P
Pathway
mgan00240  Pyrimidine metabolism
mgan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgan00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HFMG08NCA_4952 (tdk)
Enzymes [BR:mgan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HFMG08NCA_4952 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AFP81530
LinkDB All DBs
Position
846342..847016
Genome map
AA seq 224 aa AA seqDB search
MAKKNAMTTTNGWIEAICGPMFAGKTDELIRKIKRYEYADVKSLVFSPATDTRSAQEIIN
SRDGRRIGSIKIKKAFEIYDYVLLHKPQLVGIDEVQFFDDSIVEVIQTLADNQINVIVAG
LDRDFRGEPFGPIPKILGIAESVIRLTAICSECGAEASRSQRLIDNQPADYNCETILIGD
TESYAPRCRHHHKVPNRPINDQTKNFKRALKNNFDKIVEQSSKD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaagaacgcaatgaccaccactaatggttgaatcgaagcaatttgtggtccg
atgtttgctggtaaaacagatgaactaattcgcaagattaaacgttatgagtatgctgat
gtaaagtcgttggtcttttcaccagcaactgatactcgttcagctcaagagattatcaac
tctcgagatgggcgtagaattggttcaataaagatcaaaaaagcatttgaaatctatgat
tatgttttattacataaaccacaattagttggaattgacgaagtgcaattctttgatgat
tcaattgttgaagtcatccaaacattagctgataaccaaattaacgtaattgtggctggt
ttagaccgtgattttagaggtgaaccttttggtccaattcctaagattttaggaattgca
gaatcagtaatccgcttaaccgcaatctgttctgagtgtggtgctgaagctagtcgaagt
caacgtttaattgataaccaaccagctgactacaattgcgaaacgattcttattggtgac
actgaatcatacgcgccaagatgtcgtcatcaccataaagtgcctaaccggccaattaac
gaccaaaccaagaacttcaaacgtgcactaaaaaataattttgataaaatagtagagcaa
tcttcaaaagattaa

DBGET integrated database retrieval system